Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KCC001810A_C01 KCC001810A_c01
(517 letters)
Database: nr
1,537,769 sequences; 498,525,298 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_593230.1| sexual differentiation protein Esc1p [Schizosac... 32 3.7
>ref|NP_593230.1| sexual differentiation protein Esc1p [Schizosaccharomyces pombe]
gi|416968|sp|Q04635|ESC1_SCHPO Protein esc1
gi|283069|pir||S28066 sexual differentiation protein
Esc1p - fission yeast (Schizosaccharomyces pombe)
gi|4950|emb|CAA49186.1| Esc1 [Schizosaccharomyces pombe]
gi|1204238|emb|CAA93587.1| esc1 [Schizosaccharomyces
pombe]
Length = 413
Score = 32.3 bits (72), Expect = 3.7
Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
Frame = -3
Query: 497 QAVPATHMAY--SRPRALQHTQARIPAAHPVPRPFRKHFMHNFD*LPEPLDINFST*ASN 324
Q VP TH +Y S P + QH Q R+P + + PF + P+P N + AS+
Sbjct: 42 QQVPLTHNSYPLSTPSSFQHGQTRLPPINCLAEPFNR---------PQPWHSNSAAPASS 92
Database: nr
Posted date: Oct 14, 2003 12:26 AM
Number of letters in database: 498,525,298
Number of sequences in database: 1,537,769
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 516,079,897
Number of Sequences: 1537769
Number of extensions: 11151469
Number of successful extensions: 31926
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 30876
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31904
length of database: 498,525,298
effective HSP length: 115
effective length of database: 321,681,863
effective search space used: 18014184328
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)