hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/shimazu/full/sj/sj04085/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: sj04085 1110 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 206.6 3.7e-58 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RhoGAP 1/1 43 196 .. 1 159 [] 206.6 3.7e-58 Alignments of top-scoring domains: RhoGAP: domain 1 of 1, from 43 to 196: score 206.6, E = 3.7e-58 *->PlivekCieyiekrGLdtEGIyRvsGsksrikeLreafdrgedvdl. P+++ +C e++e++G ++GIyR+sG +s i++Lr++f+++ +dl+ sj04085 43 PQVLKSCAEFVEEYG-VVDGIYRLSGVSSNIQKLRQEFESERKPDLr 88 ndleeedvhvvAslLKlFLReLPePLltfelyeefieaaaesedeeerle d +d+h v+sl K ++ReLP+PLlt++ly++f e a+ ++ e erl sj04085 89 RDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAE-AVGVQLEPERLV 137 alrellrlLPpaNrdtLryLlrHLnrVaqhseveggvNkMtahNLAivFg ++ e+lr LP +N++tL++L+rHL + a++s++ + M a+NLAiv++ sj04085 138 KILEVLRELPVPNYRTLEFLMRHLVHMASFSAQ----TNMHARNLAIVWA 183 PtLlrppdgdsad<-* P+Llr++d + + sj04085 184 PNLLRSKDIEASG 196 //