hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/shimazu/full/sj/sj01602/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: sj01602 227 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CYCLIN domain present in cyclins, TFIIB and Retinob 48.1 1.1e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CYCLIN 1/1 84 186 .. 1 90 [] 48.1 1.1e-09 Alignments of top-scoring domains: CYCLIN: domain 1 of 1, from 84 to 186: score 48.1, E = 1.1e-09 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal ++ + l+l++ ++++ l++rf +++++k +s++++ +a++ sj01602 84 ELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVK-HSMEHVSMACV 129 ylAsKteeippwtktlfhytgylpp..............elayteeeile +lAsK+ee p+ +++ +++++ l++ ++++++ + ++ ++ + +i++ sj01602 130 HLASKIEEAPRRIRDVINVFHRLRQlrdkkkpvpllldqDYVNLKNQIIK 179 mekllle<-* e+ +l+ sj01602 180 AERRVLK 186 //