hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/shimazu/full/sh/sh07301/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: sh07301 454 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TPR Tetratricopeptide repeats 58.2 1.1e-12 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TPR 1/3 322 355 .. 1 34 [] 17.7 1.7 TPR 2/3 356 389 .. 1 34 [] 25.9 0.0055 TPR 3/3 397 430 .. 1 34 [] 16.3 4.2 Alignments of top-scoring domains: TPR: domain 1 of 3, from 322 to 355: score 17.7, E = 1.7 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a + +G+ y+k g++ +A++ y+kALe+d +n sh07301 322 ALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQN 355 TPR: domain 2 of 3, from 356 to 389: score 25.9, E = 0.0055 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* +eal +G +y +g +++Aie++e ALe P++ sh07301 356 VEALVARGALYATKGSLNKAIEDFELALENCPTH 389 TPR: domain 3 of 3, from 397 to 430: score 16.3, E = 4.2 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* ++l +G ++ +++ A+ yy+kAL+ld+++ sh07301 397 CQTLVERGGQLEEEEKFLNAESYYKKALALDETF 430 //