hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/shimazu/full/sh/sh06750/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: sh06750 449 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- MBT mbt repeat 405.0 7.1e-118 4 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- MBT 1/4 46 123 .. 1 77 [] 73.3 5.1e-18 MBT 2/4 159 228 .. 1 77 [] 113.8 3.4e-30 MBT 3/4 264 341 .. 1 77 [] 80.4 3.8e-20 MBT 4/4 372 443 .. 1 77 [] 146.6 4.5e-40 Alignments of top-scoring domains: MBT: domain 1 of 4, from 46 to 123: score 73.3, E = 5.1e-18 *->MKLEavDpqnp...ssicvATVvevlGrrylrlrfDGwdsdypsDfW MK E+++ + + +++ +++A V+ G+r ++lr++G+++d ++DfW sh06750 46 MKVEVLNSDAVlpsRVYWIASVIQTAGYR-VLLRYEGFENDASHDFW 91 cdvdSpdIfPvGWCeknghpLqPPpgyrskkfs<-* c+ d++P+GWC+ n++ L Pp+ + kf+ sh06750 92 CNLGTVDVHPIGWCAINSKILV-PPRTIHAKFT 123 MBT: domain 2 of 4, from 159 to 228: score 113.8, E = 3.4e-30 *->MKLEavDpqnpssicvATVvevlGrrylrlrfDGwdsdypsDfWcdv M+LE+vD++++s++++A V++v+G+r lrl +++ dsd+ DfWc++ sh06750 159 MRLEVVDKSQVSRTRMAVVDTVIGGR-LRLLYEDGDSDD--DFWCHM 202 dSpdIfPvGWCeknghpLqPPpgyrskkfs<-* +Sp I+PvGW++++gh ++ +++++ sh06750 203 WSPLIHPVGWSRRVGHGIK----MSERRSD 228 MBT: domain 3 of 4, from 264 to 341: score 80.4, E = 3.8e-20 *->MKLEavDpqnpssicvATVvevlGrrylrlrfDGwdsdypsDfWcdv MKLEa+Dp n icvATV +vl yl++ DG +s + D++c++ sh06750 264 MKLEAIDPLNLGNICVATVCKVLLDGYLMICVDGGPSTDGLDWFCYH 310 d.SpdIfPvGWCeknghpLqPPpgyrskkfs<-* +S+ IfP+ +C kn +L+PP+gy+ ++f sh06750 311 AsSHAIFPATFCQKNDIELTPPKGYEAQTFN 341 MBT: domain 4 of 4, from 372 to 443: score 146.6, E = 4.5e-40 *->MKLEavDpqnpssicvATVvevlGrrylrlrfDGwdsdypsDfWcdv MKLEavD+++p++icvATV++v++r+ l+++fDGwds+y D+W+d+ sh06750 372 MKLEAVDLMEPRLICVATVKRVVHRL-LSIHFDGWDSEY--DQWVDC 415 dSpdIfPvGWCeknghpLqPPpgyrskkfs<-* +SpdI+PvGWCe++g++LqPP ++ s sh06750 416 ESPDIYPVGWCELTGYQLQPP--VAAGVGS 443 //