hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna/full/aisin/as00036/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  as00036  706

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
AAA      ATPases associated with a variety of cellula    61.7    9.1e-14   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
AAA        1/1     486   670 ..     1    92 []    61.7  9.1e-14

Alignments of top-scoring domains:
AAA: domain 1 of 1, from 486 to 670: score 61.7, E = 9.1e-14
                   *->pgevvllvGppGsGKTTlaralarllgp..gviyidge.........
                      pge++++vG++GsGK+ l++ l rll+p++g +++dg + ++ +  +
     as00036   486    PGEKLGIVGRTGSGKSSLLLVLFRLLEPssGRVLLDGVdtsqlelaq 532  

                   ..................................................
                    +++     ++    ++  +++ + ++ ++++   +  ++ + ++   + 
     as00036   533 lrsqlaiipqepflfsgtvrenldpqglhkdralwqalkqchlsevitsm 582  

                   .............ggqrirlalalark.....dvlllDEitslld.....
                   ++ +++ ++++++   ++r++l lar+  ++ ++l +DE+t+  d++ ++
     as00036   583 ggldgelgeggrsLSLGQRQLLCLARAlltdaKILCIDEATASVDqktdq 632  

                   ............vtviattndldpallrrrfdrrivllril<-*
                   ++++   ++  ++tv+ +++   ++++++ +dr++vl  ++   
     as00036   633 llqqtickrfanKTVLTIAH---RLNTILNSDRVLVLQAGR    670  

//