hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna/full/aisin/as00017/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: as00017 291 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Sec7 Sec7 domain 310.0 2.8e-89 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Sec7 1/1 70 265 .. 1 221 [] 310.0 2.8e-89 Alignments of top-scoring domains: Sec7: domain 1 of 1, from 70 to 265: score 310.0, E = 2.8e-89 *->lksrk.kqliegrkkFNqkPkkGiedLiskglladdkdpqdiAkfLl ++++k+k+l +grkkFN++P+kGi+ i+ ll+ d qdiA fL+ as00017 70 RMAQKeKELCIGRKKFNMDPAKGIQYFIEHKLLT--PDVQDIARFLY 114 eeteGLdKkaiGefLGenddfniqvLneFvkNlFdFtglpLdeALRlfLk ++eGL+K+aiG +LGe+d+ n+qvL +Fv+ +++F +l+L++ALR+fL+ as00017 115 -KGEGLNKTAIGTYLGERDPINLQVLQAFVD-CHEFANLNLVQALRQFLW 162 sFRLPGEaQkIdRileaFSerYiqcQyNpgvfsnkkaEDdIecvqpdaDs sFRLPGEaQkIdR++eaF+ rY+ c Npgvf+++ D+ as00017 163 SFRLPGEAQKIDRMMEAFATRYCLC--NPGVFQST-------------DT 197 ayvLsYSlIMLNTDLHNNpqVKkKkikMTledFieNnrrdLREENEYEEL +yvLs+S+IMLNT+LH Np+V+++ + +e+F+ +nr as00017 198 CYVLSFSIIMLNTSLH-NPNVRDR---PPFERFVSMNR------------ 231 gindGgDlprefLtelYe.........sIkneei<-* gin+G Dlp+++L+ e +++++++++ ++ee as00017 232 GINNGSDLPEDQLRVTWEcsqrrsrerTFQKEEV 265 //