hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna/full/aisin/as00002/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  as00002  1513

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
AAA      ATPases associated with a variety of cellula   108.9    5.7e-28   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
AAA        1/2     646   830 ..     1    92 []    51.3  1.3e-10
AAA        2/2    1293  1477 ..     1    92 []    61.7  9.1e-14

Alignments of top-scoring domains:
AAA: domain 1 of 2, from 646 to 830: score 51.3, E = 1.3e-10
                   *->pgevvllvGppGsGKTTlaralarllgp...........gviyidge
                      +g  v++vG  G+GK+ l++a+a++l + +++   ++ ++ + ++++
     as00002   646    KGMLVGIVGKVGCGKSSLLAAIAGELHRlrghvavrglsKGFGLATQ 692  

                   ..................................................
                   +   +    +++   ++  + +  ++  +    +++ +    +++ + ++
     as00002   693 epwiqfatirdnilfgktfdaqlykevleacalnddlsilpagdqtevge 742  

                   ......ggqrirlalalark...dvlllDEitslld..............
                   ++   +ggqr+r+ala+a ++ + ++llD++ ++ d +  ++++++  ++
     as00002   743 kgvtlsGGQRARIALARAVYqekELYLLDDPLAAVDadvanhllhrcilg 792  

                   .....vtviattn....dldpallrrrfdrrivllril<-*
                    ++  +++++t+ ++  +  +a+l + + r i  +++    
     as00002   793 mlsytTRLLCTHRteylERADAVLLMEAGRLIRAGPPS    830  

AAA: domain 2 of 2, from 1293 to 1477: score 61.7, E = 9.1e-14
                   *->pgevvllvGppGsGKTTlaralarllgp..gviyidge.........
                      pge++++vG++GsGK+ l++ l rll+p++g +++dg + ++ +  +
     as00002  1293    PGEKLGIVGRTGSGKSSLLLVLFRLLEPssGRVLLDGVdtsqlelaq 1339 

                   ..................................................
                    +++     ++    ++  +++ + ++ ++++   +  ++ + ++   + 
     as00002  1340 lrsqlaiipqepflfsgtvrenldpqglhkdralwqalkqchlsevitsm 1389 

                   .............ggqrirlalalark.....dvlllDEitslld.....
                   ++ +++ ++++++   ++r++l lar+  ++ ++l +DE+t+  d++ ++
     as00002  1390 ggldgelgeggrsLSLGQRQLLCLARAlltdaKILCIDEATASVDqktdq 1439 

                   ............vtviattndldpallrrrfdrrivllril<-*
                   ++++   ++  ++tv+ +++   ++++++ +dr++vl  ++   
     as00002  1440 llqqtickrfanKTVLTIAH---RLNTILNSDRVLVLQAGR    1477 

//