
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= AC149306.10 - phase: 0 /pseudo
(138 letters)
Database: sprot
164,201 sequences; 59,974,054 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
YKOT_BACSU (O34755) Putative glycosyl transferase ykoT (EC 2.-.-.-) 28 7.7
>YKOT_BACSU (O34755) Putative glycosyl transferase ykoT (EC 2.-.-.-)
Length = 337
Score = 27.7 bits (60), Expect = 7.7
Identities = 19/58 (32%), Positives = 30/58 (50%), Gaps = 8/58 (13%)
Query: 85 LLSFLFQGSYMYNLFP*IFF-------FFLN-IRGVVKFLRKLLGSIGIQYVYLWIVV 134
+LSF F G +++ P FF FFL+ + G+ F++KLLG + L I +
Sbjct: 222 MLSFAFNGITSFSVAPIRFFTLLGFVLFFLSAVAGIGAFIQKLLGHTNAGWASLIISI 279
Database: sprot
Posted date: Nov 25, 2004 10:54 AM
Number of letters in database: 59,974,054
Number of sequences in database: 164,201
Lambda K H
0.368 0.170 0.704
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,243,641
Number of Sequences: 164201
Number of extensions: 387420
Number of successful extensions: 2182
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2181
Number of HSP's gapped (non-prelim): 1
length of query: 138
length of database: 59,974,054
effective HSP length: 99
effective length of query: 39
effective length of database: 43,718,155
effective search space: 1705008045
effective search space used: 1705008045
T: 11
A: 40
X1: 14 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 36 (21.7 bits)
S2: 60 (27.7 bits)
Medicago: description of AC149306.10