TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC148483.5 + phase: 0 /pseudo
         (281 letters)

Database: MTGI 
           36,976 sequences; 27,044,181 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

TC81107 similar to SP|O64948|LON1_ARATH Lon protease homolog 1  ...    27  6.7

>TC81107 similar to SP|O64948|LON1_ARATH Lon protease homolog 1
           mitochondrial precursor (EC 3.4.21.-). [Mouse-ear
           cress], partial (45%)
          Length = 1266

 Score = 27.3 bits (59), Expect = 6.7
 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +3

Query: 120 YQNYKKLRQNAKIAC*GSNIENLFQRKHNGELQRSLIWF--ILIYVALLNQVPTLVADTS 177
           Y   +KL+ +A+ +C G++++ L   KH+  L   L+W   +  Y  + +++  ++ D  
Sbjct: 534 YLAVRKLKPDARGSCVGASLDLLVLGKHHWHLLLLLLWTENLCAYPLVESRMRLILEDIG 713

Query: 178 *HLL 181
            H L
Sbjct: 714 EHTL 725


  Database: MTGI
    Posted date:  Oct 22, 2004  3:39 PM
  Number of letters in database: 27,044,181
  Number of sequences in database:  36,976
  
Lambda     K      H
   0.355    0.157    0.501 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,294,487
Number of Sequences: 36976
Number of extensions: 88652
Number of successful extensions: 982
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 981
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 982
length of query: 281
length of database: 9,014,727
effective HSP length: 95
effective length of query: 186
effective length of database: 5,502,007
effective search space: 1023373302
effective search space used: 1023373302
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.6 bits)
S2: 58 (26.9 bits)