Lotus
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TM0075.7
         (777 letters)

Database: uniref100 
           2,790,947 sequences; 848,049,833 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

UniRef100_Q869X8 Similar to Homo sapiens (Human). dentin sialoph...   212  4e-53
UniRef100_Q9NZW4 Dentin sialophosphoprotein precursor [Contains:...   211  9e-53
UniRef100_Q9T069 Hypothetical protein AT4g37820 [Arabidopsis tha...   194  8e-48
UniRef100_Q9LH98 Arabidopsis thaliana genomic DNA, chromosome 3,...   192  2e-47
UniRef100_Q9DGL1 Retinitis pigmentosa GTPase regulator-like prot...   191  9e-47
UniRef100_Q8EVB9 DNA topoisomerase IV subunit A [Mycoplasma pene...   189  2e-46
UniRef100_UPI0000180262 UPI0000180262 UniRef100 entry                 186  2e-45
UniRef100_Q8I2D8 P. falciparum RESA-like protein with DnaJ domai...   186  2e-45
UniRef100_Q7RH28 Mature-parasite-infected erythrocyte surface an...   184  7e-45
UniRef100_Q7RJB3 Erythrocyte membrane-associated giant protein a...   184  1e-44
UniRef100_P97399 Dentin sialophosphoprotein precursor (Dentin ma...   181  6e-44
UniRef100_Q8MTN7 Glutamic acid-rich protein cNBL1700 [Trichinell...   178  6e-43
UniRef100_Q88XB6 Cell surface SD repeat protein [Lactobacillus p...   177  1e-42
UniRef100_Q8VBY1 Phosphophoryn precursor [Rattus norvegicus]          175  5e-42
UniRef100_Q8ILB9 Hypothetical protein [Plasmodium falciparum]         175  5e-42
UniRef100_UPI000046BC8D UPI000046BC8D UniRef100 entry                 173  2e-41
UniRef100_Q95WA4 Spore wall protein 2 precursor [Encephalitozoon...   172  3e-41
UniRef100_Q8I414 Hypothetical protein PFE0440w [Plasmodium falci...   170  1e-40
UniRef100_UPI000043017B UPI000043017B UniRef100 entry                 169  3e-40
UniRef100_UPI000042EACE UPI000042EACE UniRef100 entry                 169  3e-40

>UniRef100_Q869X8 Similar to Homo sapiens (Human). dentin sialophosphoprotein
            [Dictyostelium discoideum]
          Length = 1206

 Score =  212 bits (539), Expect = 4e-53
 Identities = 152/714 (21%), Positives = 312/714 (43%), Gaps = 41/714 (5%)

Query: 83   DEESEHESKTEE-QINLDEVNSVDENEPE-HKPEEEHIKLDDANGVDENEVENKPEEHIK 140
            +E S H S++   Q +  E N+   NE   H+    H   D +N    +   N       
Sbjct: 479  EESSSHNSESSSGQTSSSESNNSQSNEDSNHQSSGNHPTNDSSNQGSGSHSNNHSSNQ-- 536

Query: 141  LDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKE 200
               ++G D +SE +  +     E S +++ T+ ES        E S+N  S +  +    
Sbjct: 537  -GSSSGQDSSSE-TLKIQNSNNESSDDHSSTNNESSSQGSN-NESSNNESSNQGSNNESS 593

Query: 201  NEENKHEAENKEAAEVHEEKSQQENEETKDKE--NEEIKNEVEDTEAGEVKVEKSQQENE 258
            + E  ++  N E++  +E  SQ  N E+   E  N+   NE    E+           NE
Sbjct: 594  HNETSNQGSNNESSH-NESSSQGSNNESAHNESSNQGSNNESSHNESSNQGSNNESSNNE 652

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAG-EVKEEKS 317
             +    N E  +     +    +   ++  N+ +    NE   NE  ++ +  E    +S
Sbjct: 653  SSNQGSNNESSHNESSNQGSNNESSNNESSNQGSN---NESSHNETSNQGSNNESSHNES 709

Query: 318  RQENEETKDKENEEINQNGTDVKDHVEE------NHEQDSKEEKEESNGTEAEKEEQGKI 371
              +    +   NE  NQ   +   H E       N   ++    + SN   +  E   + 
Sbjct: 710  SSQGSNNESAHNESSNQGSNNESSHNESSSQGSNNESSNNDSNNQNSNNEPSNNESSNQS 769

Query: 372  QEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNES 431
                SS  +  + E +N+    E+    ++ S+ +  S    N  YN       N ++ +
Sbjct: 770  SNNLSSNNESSNNESSNQGSNNES---SHSESSNNESSNQSLNSEYNNEPSQGSNSESSN 826

Query: 432  EMESQKSGTETNEVTDSNATTNIQENG-----GENQAQTDNGSEKRSTSESGGQQHQEQN 486
            E  +Q   +E+N  + S+ + +   N      G N   ++N S  + +S          N
Sbjct: 827  ESSNQSLNSESNNDSSSHGSNSESSNNESSSHGSNNESSNNESSSQDSSNYSSNNGSSNN 886

Query: 487  NPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAG 546
              +S G     S+  + NE++++ +  Q   +E ++++  + S++  +   E SN +++ 
Sbjct: 887  ESSSQGSNNESSNQGSNNESSNNESSSQGSNNESSHNEPSNQSSNNESSNNESSNNESSN 946

Query: 547  DDVDSTYKSSSGNSDSNANNGAYKETTNLVQN-ENPNGNSVQEGKQDASHEAQLTASDTS 605
            ++  S   ++  +++ ++N G+  E++N   N E+ N  S  +G  + S   + + +++S
Sbjct: 947  NESSSKGSNNESSNNESSNQGSNNESSNNESNNESSNNESSSQGSNNESSNNESSNNESS 1006

Query: 606  SEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSS 665
            S+   + SSN E++     N++ +S GSN  S    ++N+ +S  ++++ SS+ S   SS
Sbjct: 1007 SQSSNNGSSNNESSNQGSNNES-SSHGSNNESSSKGSNNESSSHGSNNESSSQGSNNESS 1065

Query: 666  NSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDES 725
            N+E+S+  + N S++NE+ +  ++++++ NE+S Q   +E+    + N++  +E +  E 
Sbjct: 1066 NNESSNQNSNNESSNNESSSKGSNNESSNNESSSQGSNNESSNNESNNQNSNNESSHKEE 1125

Query: 726  AHS-----------DEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAES 768
            + S           D+ SNS + +Q S S  S +   + S  +  +    N++S
Sbjct: 1126 SESNSHQSSETESKDQVSNSGSMNQSSESSESSSLSEQSSAFESSSSSSGNSQS 1179



 Score =  202 bits (515), Expect = 2e-50
 Identities = 163/707 (23%), Positives = 303/707 (42%), Gaps = 65/707 (9%)

Query: 107  NEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDD------ANGVDENSEHSQDLVEH 160
            N+P  KP    +     +   +  +++  EE    +        +  + N+  S +   H
Sbjct: 450  NKPTPKPTSPPLTKKPTSPPTQPPIQSPTEESSSHNSESSSGQTSSSESNNSQSNEDSNH 509

Query: 161  EGEGS-----SENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENK--HEAENKEA 213
            +  G+     S N  +   S  H    G  S    S E   +   N E+   H + N E+
Sbjct: 510  QSSGNHPTNDSSNQGSGSHSNNHSSNQGSSSGQDSSSETLKIQNSNNESSDDHSSTNNES 569

Query: 214  AEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVE 273
            +          NE +    N E  +     +       +S      ++   NE   NE  
Sbjct: 570  SSQGSNNESSNNESSNQGSNNESSHNETSNQGSN---NESSHNESSSQGSNNESAHNESS 626

Query: 274  DKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEIN 333
            ++ +                +  N E  N+  + E+   +       NE +    NE  N
Sbjct: 627  NQGSNNESSHNESSNQGSNNESSNNESSNQGSNNESSHNESSNQGSNNESSN---NESSN 683

Query: 334  QNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHRE 393
            Q   +   H E +++  + E          E   QG   E A +E   Q G  N   H E
Sbjct: 684  QGSNNESSHNETSNQGSNNESSHN------ESSSQGSNNESAHNESSNQ-GSNNESSHNE 736

Query: 394  ENYAG-DNASSAVDHKSQDIFNESYNKTEQ-------VDKNEKNESEMESQKSGTETNEV 445
             +  G +N SS  D  +Q+  NE  N              NE + +E  +Q S  E++  
Sbjct: 737  SSSQGSNNESSNNDSNNQNSNNEPSNNESSNQSSNNLSSNNESSNNESSNQGSNNESSHS 796

Query: 446  TDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQ-HQEQNNPTSDGVETVDSSSQNGN 504
              SN  ++ Q    E   +   GS   S++ES  Q  + E NN +S      +SS+   N
Sbjct: 797  ESSNNESSNQSLNSEYNNEPSQGSNSESSNESSNQSLNSESNNDSSSHGSNSESSN---N 853

Query: 505  ETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNA 564
            E++SH ++ ++  +E ++    + S++  +   E S+  +  +  +    + S N++S++
Sbjct: 854  ESSSHGSNNESSNNESSSQDSSNYSSNNGSSNNESSSQGSNNESSNQGSNNESSNNESSS 913

Query: 565  ----NNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTAS-------DTSSEQKKDES 613
                N  ++ E +N   N N + N+     + +++E+    S       ++S++   +ES
Sbjct: 914  QGSNNESSHNEPSNQSSN-NESSNNESSNNESSNNESSSKGSNNESSNNESSNQGSNNES 972

Query: 614  SNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSS-EESKEGSSNSENSSD 672
            SN E+N +S  N++ +S GSN  S  + + N E+S  +S++ SS  ES    SN+E+SS 
Sbjct: 973  SNNESNNESSNNES-SSQGSNNESSNNESSNNESSSQSSNNGSSNNESSNQGSNNESSSH 1031

Query: 673  ANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESA---HSD 729
             + N S+S  ++N ++SH +N NE+S Q   +E+    + N++  +E + +ES+    ++
Sbjct: 1032 GSNNESSSKGSNNESSSHGSN-NESSSQGSNNESSNNESSNQNSNNESSNNESSSKGSNN 1090

Query: 730  EGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
            E SN+ ++ QGS+++ S  E   ++         SN ES+H++ S +
Sbjct: 1091 ESSNNESSSQGSNNESSNNESNNQN---------SNNESSHKEESES 1128



 Score =  201 bits (510), Expect = 9e-50
 Identities = 157/673 (23%), Positives = 302/673 (44%), Gaps = 51/673 (7%)

Query: 79   HKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEH 138
            H   + ES  +    E  N +  N    NE  H  E  +   ++ +  +E+  +    E 
Sbjct: 562  HSSTNNESSSQGSNNESSNNESSNQGSNNESSHN-ETSNQGSNNESSHNESSSQGSNNES 620

Query: 139  IKLDDAN-GVDENSEHSQDLVEHEGEGSSENARTDIESEQ---HVEKVGEESDNTESKEN 194
               + +N G +  S H++   +     SS N  ++  S     H E   + S+N  S   
Sbjct: 621  AHNESSNQGSNNESSHNESSNQGSNNESSNNESSNQGSNNESSHNESSNQGSNNESSNNE 680

Query: 195  DSLVKENEENKH-----EAENKEAAEVHEEKSQQENEETKDKE--NEEIKNEVEDTEAGE 247
             S    N E+ H     +  N E++  +E  SQ  N E+   E  N+   NE    E+  
Sbjct: 681  SSNQGSNNESSHNETSNQGSNNESSH-NESSSQGSNNESAHNESSNQGSNNESSHNESS- 738

Query: 248  VKVEKSQQENEETK--DKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVE 305
                 SQ  N E+   D  N+   NE  + E+           NE +    N E  N+  
Sbjct: 739  -----SQGSNNESSNNDSNNQNSNNEPSNNESSNQSSNNLSSNNESS----NNESSNQGS 789

Query: 306  DKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEK 365
            + E+   +   +   N+    + N E +Q         E ++E  ++    ESN   +  
Sbjct: 790  NNESSHSESSNNESSNQSLNSEYNNEPSQGSNS-----ESSNESSNQSLNSESNNDSSSH 844

Query: 366  EEQGKIQEEASSEKQVQDGEGNNEQHREE--NYAGDNASSAVDHKSQDIFNESYNKTEQV 423
                +     SS     +   NNE   ++  NY+ +N SS  +  SQ   NES N   Q 
Sbjct: 845  GSNSESSNNESSSHGSNNESSNNESSSQDSSNYSSNNGSSNNESSSQGSNNESSN---QG 901

Query: 424  DKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQ 483
              NE + +E  SQ S  E++    SN ++N   N   N   ++N S    +S  G     
Sbjct: 902  SNNESSNNESSSQGSNNESSHNEPSNQSSN---NESSNNESSNNESSNNESSSKGSNNES 958

Query: 484  EQNNPTSDGVETVDSSSQNGNETTSHTTDKQ---NETSEDANSKVEDSSTDTTTPKTEDS 540
              N  ++ G     S++++ NE++++ +  Q   NE+S + +S  E SS  +    + + 
Sbjct: 959  SNNESSNQGSNNESSNNESNNESSNNESSSQGSNNESSNNESSNNESSSQSSNNGSSNNE 1018

Query: 541  NADAAGDDVDSTY-----KSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASH 595
            +++   ++  S++      SS G+++ ++++G+  E+++  Q  N   ++ +   Q++++
Sbjct: 1019 SSNQGSNNESSSHGSNNESSSKGSNNESSSHGSNNESSS--QGSNNESSNNESSNQNSNN 1076

Query: 596  EAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDV 655
            E+  + +++SS+   +ESSN E+++    N++ N++ +N NS   ++ +KE S+ NS   
Sbjct: 1077 ES--SNNESSSKGSNNESSNNESSSQGSNNESSNNESNNQNSNNESS-HKEESESNSHQS 1133

Query: 656  SSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNES 715
            S  ESK+  SNS + + ++++  +S+ ++  +A   ++ +  + Q K+SEND  ++ + S
Sbjct: 1134 SETESKDQVSNSGSMNQSSESSESSSLSEQSSAFESSSSSSGNSQSKSSENDDSSSSSGS 1193

Query: 716  VESEKAKDESAHS 728
              S  A+  +  S
Sbjct: 1194 KNSNSAQSSAFSS 1206



 Score =  177 bits (448), Expect = 1e-42
 Identities = 146/671 (21%), Positives = 287/671 (42%), Gaps = 59/671 (8%)

Query: 40   TNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLD 99
            TN + +S G + ++ N+       +      ET+   + ++    ES  +    E  + +
Sbjct: 565  TNNESSSQGSNNESSNNESSNQGSNNESSHNETSNQGSNNESSHNESSSQGSNNESAHNE 624

Query: 100  EVNSVDENEPEH-KPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLV 158
              N    NE  H +   +    + +N    N+  N    H   ++++    N+E S +  
Sbjct: 625  SSNQGSNNESSHNESSNQGSNNESSNNESSNQGSNNESSH---NESSNQGSNNESSNN-- 679

Query: 159  EHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHE 218
            E   +GS+  +  +  S Q      E S N  S +  +    + E+ ++  N E++  +E
Sbjct: 680  ESSNQGSNNESSHNETSNQGSNN--ESSHNESSSQGSNNESAHNESSNQGSNNESSH-NE 736

Query: 219  EKSQQENEETK--DKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKE------NEEIKN 270
              SQ  N E+   D  N+   NE  + E+           NE + ++       NE   +
Sbjct: 737  SSSQGSNNESSNNDSNNQNSNNEPSNNESSNQSSNNLSSNNESSNNESSNQGSNNESSHS 796

Query: 271  EVEDKEAG------EVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEET 324
            E  + E+       E   E SQ  N E+ ++ + +  N   + ++           NE +
Sbjct: 797  ESSNNESSNQSLNSEYNNEPSQGSNSESSNESSNQSLNSESNNDSSSHGSNSESSNNESS 856

Query: 325  KDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDG 384
                N E + N +  +D    +    S   +  S G+  E   QG   E +++E   Q G
Sbjct: 857  SHGSNNESSNNESSSQDSSNYSSNNGSSNNESSSQGSNNESSNQGSNNESSNNESSSQ-G 915

Query: 385  EGNNEQHRE-----------ENYAGDNASSAVDHKSQDIFNESYNK--TEQVDKNEKNES 431
              N   H E            N + +N SS  +  S+   NES N   + Q   NE + +
Sbjct: 916  SNNESSHNEPSNQSSNNESSNNESSNNESSNNESSSKGSNNESSNNESSNQGSNNESSNN 975

Query: 432  EMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSD 491
            E  ++ S  E++    +N ++N + +  E+ +Q+ N     + S + G      N  +S 
Sbjct: 976  ESNNESSNNESSSQGSNNESSNNESSNNESSSQSSNNGSSNNESSNQGSN----NESSSH 1031

Query: 492  GVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDS 551
            G     SS  + NE++SH ++ ++ +S+ +N++  ++ +       E SN ++       
Sbjct: 1032 GSNNESSSKGSNNESSSHGSNNES-SSQGSNNESSNNESSNQNSNNESSNNES------- 1083

Query: 552  TYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKD 611
               SS G+++ ++NN +  + +N   + N + N  Q    ++SH+ +   S+++S Q  +
Sbjct: 1084 ---SSKGSNNESSNNESSSQGSNNESSNNESNN--QNSNNESSHKEE---SESNSHQSSE 1135

Query: 612  -ESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSE-ESKEGSSNSEN 669
             ES +  +N+ S+   + +S+ S+ + + SA ++  +S  NS   SSE +    SS S+N
Sbjct: 1136 TESKDQVSNSGSMNQSSESSESSSLSEQSSAFESSSSSSGNSQSKSSENDDSSSSSGSKN 1195

Query: 670  SSDANQNGSNS 680
            S+ A  +  +S
Sbjct: 1196 SNSAQSSAFSS 1206



 Score =  137 bits (345), Expect = 1e-30
 Identities = 91/350 (26%), Positives = 188/350 (53%), Gaps = 27/350 (7%)

Query: 442 TNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQ 501
           T+  T     +  +E+   N   +++ S + S+SES   Q  E +N  S G    + SS 
Sbjct: 466 TSPPTQPPIQSPTEESSSHN---SESSSGQTSSSESNNSQSNEDSNHQSSGNHPTNDSSN 522

Query: 502 NGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS-GNS 560
            G+ + S+     N +S   +S  +DSS++T   K ++SN +++ D   +  +SSS G++
Sbjct: 523 QGSGSHSN-----NHSSNQGSSSGQDSSSETL--KIQNSNNESSDDHSSTNNESSSQGSN 575

Query: 561 DSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNT 620
           + ++NN +  + +N   NE+ +  +  +G  + S   + ++  +++E   +ESSN  +N 
Sbjct: 576 NESSNNESSNQGSN---NESSHNETSNQGSNNESSHNESSSQGSNNESAHNESSNQGSNN 632

Query: 621 DSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNS 680
           +S  N++ N   +N +S   +++    ++ + ++ S++ S   SSN+E+S+  + N S+ 
Sbjct: 633 ESSHNESSNQGSNNESSNNESSNQGSNNESSHNESSNQGSNNESSNNESSNQGSNNESSH 692

Query: 681 NENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAH---SDEGSNSNTN 737
           NE  N  ++++++ NE+S Q   +E+    + N+   +E + +ES+    ++E SN+++N
Sbjct: 693 NETSNQGSNNESSHNESSSQGSNNESAHNESSNQGSNNESSHNESSSQGSNNESSNNDSN 752

Query: 738 DQGSSSDPSITEEVKESHIDLGTLPE----------SNAESNHRDVSSAE 777
           +Q S+++PS  E   +S  +L +  E          SN ES+H + S+ E
Sbjct: 753 NQNSNNEPSNNESSNQSSNNLSSNNESSNNESSNQGSNNESSHSESSNNE 802


>UniRef100_Q9NZW4 Dentin sialophosphoprotein precursor [Contains: Dentin phosphoprotein
            (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)]
            [Homo sapiens]
          Length = 1253

 Score =  211 bits (536), Expect = 9e-53
 Identities = 134/750 (17%), Positives = 339/750 (44%), Gaps = 28/750 (3%)

Query: 44   KASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNS 103
            K + G+  K  + ++ LG+ ++    E   +     K +       S T    N D  +S
Sbjct: 394  KGNEGKEDKGQHGMI-LGKGNVKTQGEVVNIEGPGQKSEPGNKVGHSNTGSDSNSDGYDS 452

Query: 104  VDENEPEHKPEE-----EHIKLDDANGVDENEVENKPEEHIKLDDA----NGVD------ 148
             D ++   + ++     E    DDAN   +N   ++ +     D++    NG D      
Sbjct: 453  YDFDDKSMQGDDPNSSDESNGNDDANSESDNNSSSRGDASYNSDESKDNGNGSDSKGAED 512

Query: 149  ENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEA 208
            ++S+ + D    +  G+  N   D +     +   + SD+  S  ++S    +  +   +
Sbjct: 513  DDSDSTSDTNNSDSNGNGNNGNDDNDKSDSGKGKSDSSDSDSSDSSNSSDSSDSSDSDSS 572

Query: 209  ENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEI 268
            ++  +++   + S  ++ ++ D ++ +  N  + +++ +        ++ ++ D +++  
Sbjct: 573  DSNSSSD--SDSSDSDSSDSSDSDSSDSSNSSDSSDSSD---SSDSSDSSDSSDSKSDSS 627

Query: 269  KNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKE 328
            K+E  D    + K + S   + ++ D  N +  +      + +  +     ++  + D  
Sbjct: 628  KSE-SDSSDSDSKSDSSDSNSSDSSD--NSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSS 684

Query: 329  NEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNN 388
            +   + N +D  D  + ++  +S +  + S+   ++  +        S      D   ++
Sbjct: 685  SSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSS 744

Query: 389  EQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDS 448
            +     N + D++ S+    S D  + S +       N  + ++  +    ++++  +DS
Sbjct: 745  DSSDSSN-SSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDS 803

Query: 449  NATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETT- 507
            + +++  ++   + + + N S+  ++S+S    +   ++ +SD  ++ DS S N ++++ 
Sbjct: 804  SNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDSSDSDSSNRSDSSN 863

Query: 508  -SHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANN 566
             S ++D  + ++   +S   DSS    +  + DS+  +   D DS+  S+S +S  ++N+
Sbjct: 864  SSDSSDSSDSSNSSDSSDSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSNSSDSSDSSNS 923

Query: 567  GAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQND 626
                E++N   N N + +S      D+S  +  + S  S +      S+   ++DS  + 
Sbjct: 924  SDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSGDSSNSSDSSDSNSSDSSDSS 983

Query: 627  NVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNG 686
            N +    +++S  S++ +  ++  +SSD S       SS+S NSSD++ +  +S+ +D+ 
Sbjct: 984  NSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSDSSDSSDSSDSS 1043

Query: 687  NASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPS 746
            ++S+ ++ +++S    +S++ G +  ++S +S  + D S  SD   +S++++   SSD S
Sbjct: 1044 DSSNSSDSSDSSDSSDSSDSSGSSDSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSS 1103

Query: 747  ITEEVKESHIDLGTLPESNAESNHRDVSSA 776
             + +  +S  D     +S+  S+  D S++
Sbjct: 1104 DSSDSSDSS-DSSDSSDSSDSSDSSDSSNS 1132



 Score =  207 bits (526), Expect = 1e-51
 Identities = 130/718 (18%), Positives = 325/718 (45%), Gaps = 26/718 (3%)

Query: 70   EETTVVDARHKEQDEESEHESKTEEQINLDEV-NSVDENEPEHKPEEEHIKLDDANGVDE 128
            +E+   D  + E D  S   S+ +   N DE  ++ + ++ +   +++     D N  D 
Sbjct: 469  DESNGNDDANSESDNNSS--SRGDASYNSDESKDNGNGSDSKGAEDDDSDSTSDTNNSDS 526

Query: 129  N-EVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESD 187
            N    N  +++ K D   G  ++S+       +  + S  +     +S    +    +SD
Sbjct: 527  NGNGNNGNDDNDKSDSGKGKSDSSDSDSSDSSNSSDSSDSSDSDSSDSNSSSDSDSSDSD 586

Query: 188  NTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETK---DKENEEIKNEVEDTE 244
            +++S ++DS    N  +  ++ +   +    + S  +++ +K   D  + + K++  D+ 
Sbjct: 587  SSDSSDSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSDSSDSN 646

Query: 245  AGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEV 304
            + +        +N ++ D  N    N  +  ++ +  +  S  ++  + D  N    ++ 
Sbjct: 647  SSD------SSDNSDSSDSSNS--SNSSDSSDSSDSSDSSSSSDSSSSSDSSNSSDSSDS 698

Query: 305  ED-KEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEA 363
             D   + E  +     +++ +   ++   N + +D  +  + +   DS +    S+ +++
Sbjct: 699  SDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSDSSDSSNSSDSSDS 758

Query: 364  EKEEQGKIQEEASSEKQVQDGEGNNEQHREENYA-GDNASSAVDHKSQDIFNESYNKTEQ 422
                      ++S      D   +++ +   N +   ++S++ D  +    ++S + ++ 
Sbjct: 759  SDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDS 818

Query: 423  VDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQH 482
               N  + S        + +++ +DS+ +++  ++   N++ + N S+   +S+S     
Sbjct: 819  DSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDSSDSDSSNRSDSSNSSDSSDSSDSSNSSD 878

Query: 483  QEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNA 542
               ++ +SD  E+ +SS  + +  +S +    +  S D++     S +  ++  +++SN+
Sbjct: 879  SSDSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNS 938

Query: 543  DAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTAS 602
              + +  DS+  S S NS  ++N+G   +++N   + + N +   +    +       +S
Sbjct: 939  SDSSNSSDSSDSSDSSNSSDSSNSG---DSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSS 995

Query: 603  DTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEAS----QVNSSDVSSE 658
            D+S       SS++  ++DS  + N +SD SN++    ++D+ ++S      NSSD S  
Sbjct: 996  DSSDSSDSSNSSDSSDSSDSSDSSN-SSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDS 1054

Query: 659  ESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVES 718
                 SS+S  SSD++ +  +S+ +D+ ++S  ++ +++S    +S++   +  ++S +S
Sbjct: 1055 SDSSDSSDSSGSSDSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSDSSDSSDSSDS 1114

Query: 719  EKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
              + D S  SD   +SN++D   SSD S + +  +S  D     +S+  S+  D S +
Sbjct: 1115 SDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSS-DSSDSSDSSDSSDSSDSSDS 1171



 Score =  207 bits (526), Expect = 1e-51
 Identities = 128/716 (17%), Positives = 322/716 (44%), Gaps = 24/716 (3%)

Query: 80   KEQDEESEHESKTEEQINLD---EVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPE 136
            + +D  +  +SK  E  + D   + N+ D N   +   +++ K D   G  ++   +  +
Sbjct: 497  ESKDNGNGSDSKGAEDDDSDSTSDTNNSDSNGNGNNGNDDNDKSDSGKGKSDSSDSDSSD 556

Query: 137  EHIKLD-----DANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTES 191
                 D     D++  D NS    D  + +   SS++  +D  +        + SD+++S
Sbjct: 557  SSNSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDS 616

Query: 192  KENDSLVKENEENKHEAENKEA---AEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEV 248
              +DS   +++ +K E+++ ++   ++  +  S   ++ +   ++    N  + +++ + 
Sbjct: 617  --SDSSDSKSDSSKSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDS 674

Query: 249  KVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKN--EVED 306
                S  ++  + D  N    ++  D        + S   + ++ D  +    N  + + 
Sbjct: 675  SDSSSSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDS 734

Query: 307  KEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKE 366
              + +  +     ++  + D  +   + N +D  D  + +   DS    + ++ + +   
Sbjct: 735  SNSSDSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDS 794

Query: 367  EQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKN 426
                   ++S+     D   +++     +    N+S + D  +    ++S + ++  D +
Sbjct: 795  SDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDSSDSD 854

Query: 427  EKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQN 486
              N S+  +    +++++ ++S+ +++  ++   N++   + S   S S          +
Sbjct: 855  SSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSNS 914

Query: 487  NPTSDGVETVDS-----SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSN 541
            + +SD   + DS     SS N N + S  +   +++S+ +NS   DSS    +  + DS+
Sbjct: 915  SDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNS--SDSSNSGDSSNSSDSS 972

Query: 542  ADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLT- 600
               + D  DS+  S S +S  ++++    +++N   + + + +S      D+S+ +  + 
Sbjct: 973  DSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSD 1032

Query: 601  ASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEES 660
            +SD+S      +SSN+  ++DS  + + +    +++S  S++ +  +   +SSD S    
Sbjct: 1033 SSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSGSSDSSDSSDSSDSSDSSDSSDSSDSSD 1092

Query: 661  KEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEK 720
               SS+S +SSD++ +  +S+ +D+ ++S  ++ +++S    +S++   +  ++S +S  
Sbjct: 1093 SSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSD 1152

Query: 721  AKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
            + D S  SD   +S+++D   SSD S + +  ES  D     +S+  SN  D S +
Sbjct: 1153 SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESS-DSSDSSDSSDSSNSSDSSDS 1207



 Score =  204 bits (518), Expect = 1e-50
 Identities = 129/702 (18%), Positives = 323/702 (45%), Gaps = 35/702 (4%)

Query: 83   DEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLD 142
            D +S   S + +  +  + +S D N        +    D ++  D ++  N  +     D
Sbjct: 551  DSDSSDSSNSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDS-DSSDSSNSSDSSDSSD 609

Query: 143  DANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKE-----NDSL 197
             ++  D  S  S D      +  S+++ +D +S+       + SDN++S +     N S 
Sbjct: 610  SSDSSD--SSDSSDSKSDSSKSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSD 667

Query: 198  VKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQEN 257
              ++ ++   + + +++   +  +  ++ ++ D  N    ++  D+   +   + S   N
Sbjct: 668  SSDSSDSSDSSSSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSS-DSSDSSN 726

Query: 258  EETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDK----EAGEVK 313
              + D ++    N  +  ++ +  +  +  ++ ++ D  N    ++  D     ++    
Sbjct: 727  SNSSDSDSS---NSSDSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSS 783

Query: 314  EEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQE 373
            +      + ++ D  N   + N +D  D   ++ + DS    + SN +++          
Sbjct: 784  DSNDSSNSSDSSDSSNSSDSSNSSDSSDS-SDSSDSDSSNSSDSSNSSDSSDSSNSSDSS 842

Query: 374  EASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEM 433
            ++S      D + +N           N+S + D       ++S + ++  D NE + S  
Sbjct: 843  DSSDSSDSSDSDSSNRSD------SSNSSDSSDSSDSSNSSDSSDSSDSSDSNESSNSSD 896

Query: 434  ESQKSGTETNEVTD-SNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDG 492
             S  S +  ++ +D SN++ +   +   + +++ N S+  ++S+S    +   ++ +SD 
Sbjct: 897  SSDSSNSSDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSDS---SNSSDSSDSSDS 953

Query: 493  VETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDST 552
              + DSS+   +  +S ++D  +  S D+++  + S +  ++  ++ S++  + D  DS+
Sbjct: 954  SNSSDSSNSGDSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSS 1013

Query: 553  YKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDE 612
              S S NS  ++N+    ++++   + + + +S      D+S  +   +SD+S      +
Sbjct: 1014 DSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSD--SSDSSGSSDSSD 1071

Query: 613  SSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSD 672
            SS++  ++DS    + +SD S+++    ++D+ ++S  +SSD S       SS+S +SSD
Sbjct: 1072 SSDSSDSSDS----SDSSDSSDSSDSSESSDSSDSS--DSSDSSDSSDSSDSSDSSDSSD 1125

Query: 673  ANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGS 732
            ++ + ++S+ +D+ ++S  ++ +++S    +S++   +  ++S +S  + D S  SD   
Sbjct: 1126 SSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNE 1185

Query: 733  NSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVS 774
            +S+++D   SSD S + +  +S     +  +SN ES+ +  S
Sbjct: 1186 SSDSSDSSDSSDSSNSSDSSDSSDSSDSTSDSNDESDSQSKS 1227



 Score =  200 bits (508), Expect = 2e-49
 Identities = 126/717 (17%), Positives = 328/717 (45%), Gaps = 32/717 (4%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIK---LDDANGVDENEVENKPEE 137
            ++  + +  + ++E    D+ NS  +N    + +  +      D+ NG D    E+   +
Sbjct: 457  DKSMQGDDPNSSDESNGNDDANSESDNNSSSRGDASYNSDESKDNGNGSDSKGAEDDDSD 516

Query: 138  HIK---LDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDN------ 188
                    D+NG   N     D  +  G+G S+++ +D     +     + SD+      
Sbjct: 517  STSDTNNSDSNGNGNNGNDDNDKSD-SGKGKSDSSDSDSSDSSNSSDSSDSSDSDSSDSN 575

Query: 189  ----TESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTE 244
                ++S ++DS    + ++   + + ++++  +     ++ ++ D +++  K+E  D+ 
Sbjct: 576  SSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSE-SDSS 634

Query: 245  AGEVKVEKSQQENEETKDK----ENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEI 300
              + K + S   + ++ D     ++    N  +  ++ +  +  S  ++  + D  N   
Sbjct: 635  DSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSSSSDSSNSSD 694

Query: 301  KNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNG 360
             ++  D        + S   + ++ D  +   N N +D  D    +   DS +  + SN 
Sbjct: 695  SSDSSDSSNSSESSDSSDSSDSDSSDSSDSS-NSNSSD-SDSSNSSDSSDSSDSSDSSNS 752

Query: 361  TEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKT 420
            +++          ++S      D   ++    + N + +++ S+    S D    S N +
Sbjct: 753  SDSSDSSDSSNSSDSSDSSDSSDSSDSSNSS-DSNDSSNSSDSSDSSNSSD----SSNSS 807

Query: 421  EQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQ 480
            +  D ++ ++S+  +    + +++ +DS+ +++  ++   + +   + S +  +S S   
Sbjct: 808  DSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDSSDSDSSNRSDSSNSSDS 867

Query: 481  QHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDS 540
                 ++ +SD  ++ DSS  N +  +S ++D  N +  D++     S +  ++  ++ S
Sbjct: 868  SDSSDSSNSSDSSDSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSS 927

Query: 541  NADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLT 600
             +  + D+ +S+  S+S +S  ++++    +++N   + N + +S       +       
Sbjct: 928  ESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSGDSSNSSDSSDSNSSDSSDSSNSSD 987

Query: 601  ASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVN-SSDVSSEE 659
            +SD+S      +SS++  ++DS  + + +SD SN++   +++D+ ++S  + SSD S   
Sbjct: 988  SSDSSDSSDSSDSSDSSNSSDSSDSSD-SSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSS 1046

Query: 660  SKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESE 719
            +   SS+S +SSD++ +  +S+ +D+ ++S  ++ +++S    +S++   +  ++S +S 
Sbjct: 1047 NSSDSSDSSDSSDSSDSSGSSDSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSDSS 1106

Query: 720  KAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
             + D S  SD   +S+++D   SS+ S + +  +S  D     +S+  S+  D S +
Sbjct: 1107 DSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSS-DSSDSSDSSDSSDSSDSSDS 1162



 Score =  197 bits (502), Expect = 8e-49
 Identities = 175/770 (22%), Positives = 344/770 (43%), Gaps = 79/770 (10%)

Query: 61  GRKDLNPLVEETTVVDARHKE-----QDEESEHESKTEEQINLDEV--NSV--DENEPEH 111
           G  D N   +   V DA H E     Q++  +         N DE+  NS   + N  E 
Sbjct: 156 GNTDKN--TQNGDVGDAGHNEDVAVVQEDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEI 213

Query: 112 KPEEEHIKLDDANGVDENEVENKPEEHIKLDDA------NGVDENSEHSQDLVEHEGEGS 165
            P+    +    NG  E EV     E   LD++      NG DE+        E EG G 
Sbjct: 214 TPQINSKR----NGTKEAEVTPGTGEDAGLDNSDGSPSGNGADED--------EDEGSGD 261

Query: 166 SENARTDIESEQHVEKVGEE-SDNTESKENDSLVKENEENK--HEAENKEAA--EVHEEK 220
            E+       +      G+E  D+ +  ++DS + +N ++K  ++ E KE    EV  +K
Sbjct: 262 DEDEEAGNGKDSSNNSKGQEGQDHGKEDDHDSSIGQNSDSKEYYDPEGKEDPHNEVDGDK 321

Query: 221 SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKN------EVED 274
           + +  E +     +     +EDT+    + E  + EN  TK+ E   +        E++ 
Sbjct: 322 TSKSEENSAGIPEDNGSQRIEDTQKLNHR-ESKRVENRITKESETHAVGKSQDKGIEIKG 380

Query: 275 KEAGEVKEEKSQQENEETKDKENEE--IKNEVEDKEAGEVKE-----EKSRQENEETKDK 327
             +G     K   +  E K+ + +   I  +   K  GEV       +KS   N+     
Sbjct: 381 PSSGNRNITKEVGKGNEGKEDKGQHGMILGKGNVKTQGEVVNIEGPGQKSEPGNKVGHSN 440

Query: 328 ENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTE---AEKEEQGKIQEEAS--SEKQVQ 382
              + N +G D  D  +++ + D     +ESNG +   +E +     + +AS  S++   
Sbjct: 441 TGSDSNSDGYDSYDFDDKSMQGDDPNSSDESNGNDDANSESDNNSSSRGDASYNSDESKD 500

Query: 383 DGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS---- 438
           +G G++ +  E+    D++ S  D  + D      N  +  DK++  + + +S  S    
Sbjct: 501 NGNGSDSKGAED----DDSDSTSDTNNSDSNGNGNNGNDDNDKSDSGKGKSDSSDSDSSD 556

Query: 439 GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDS 498
            + +++ +DS+ + +   N   +   +D+ S   S S+S    +   ++ +SD  ++ DS
Sbjct: 557 SSNSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDS 616

Query: 499 SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
           S  + +++ S  ++  +  S D+ S   DS++  ++  ++ S++  + +  DS+  S S 
Sbjct: 617 SDSSDSKSDSSKSESDSSDS-DSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSS 675

Query: 559 NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
           +S S++++ +  +++N   + + + +S      D+S  +   +SD+S     + S +  +
Sbjct: 676 DSSSSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSS 735

Query: 619 NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
           N+    + + +SD SN++    ++D+      NSSD S       SS+S NSSD+N + +
Sbjct: 736 NSSDSSDSSDSSDSSNSSDSSDSSDSS-----NSSDSSDSSDSSDSSDSSNSSDSNDSSN 790

Query: 679 NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKA----------KDESAHS 728
           +S+ +D+ N+S  +N +++S    +S++D   + + S  S+ +            +S+ S
Sbjct: 791 SSDSSDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDS 850

Query: 729 DEGSNSNTNDQGSSSDPSITEEVKES--HIDLGTLPESNAESNHRDVSSA 776
            +  +SN +D  +SSD S + +   S    D     +SN  SN  D S +
Sbjct: 851 SDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSNESSNSSDSSDS 900



 Score =  192 bits (489), Expect = 2e-47
 Identities = 120/715 (16%), Positives = 307/715 (42%), Gaps = 15/715 (2%)

Query: 49   ESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDE-N 107
            +S K  +D       D +   + +   D+   + +  S+ +S   +  +  + +S D  N
Sbjct: 541  DSGKGKSDSSDSDSSDSSNSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSN 600

Query: 108  EPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSE 167
              +     +     D++   +++ ++   E    D  +  D +  +S D  ++     S 
Sbjct: 601  SSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSS 660

Query: 168  NARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEE 227
            N+    +S    +     S +  S  +DS    +  +  ++ N   +    + S  ++ +
Sbjct: 661  NSSNSSDSSDSSDSSDSSSSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSD 720

Query: 228  TKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQ 287
            + D  N    +      +       S   +  +   ++ +  N  +  ++ +  +     
Sbjct: 721  SSDSSNSNSSDSDSSNSSDSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSS 780

Query: 288  ENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENH 347
             + ++ D  N    ++  +        + S   +    D  N   + N +D  D    + 
Sbjct: 781  NSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSD 840

Query: 348  EQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVD- 406
              DS +  + S+   + + +     + + S       + ++     ++    N+S + D 
Sbjct: 841  SSDSSDSSDSSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSNESSNSSDSSDS 900

Query: 407  -HKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQT 465
             + S    ++S N ++  D +  ++S  ES  S   +N    SN++ +   +   N + +
Sbjct: 901  SNSSDSDSSDSSNSSDSSDSSNSSDSS-ESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDS 959

Query: 466  DNGSEKRSTSESGGQQHQEQNNPT--SDGVETVDSSSQNGNETTSHTTDKQN--ETSEDA 521
             N  +  ++S+S      + ++ +  SD  ++ DSS  + +  +S+++D  +  ++S+ +
Sbjct: 960  SNSGDSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSS 1019

Query: 522  NSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENP 581
            NS    +S+D++       ++D++     S    SS +SDS+ ++G+   + +   +++ 
Sbjct: 1020 NSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSGSSDSSDSSDSSDSS 1079

Query: 582  NGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSA 641
            + +   +    +       +SD+S      +SS++  ++DS  + + +SD SN++    +
Sbjct: 1080 DSSDSSDSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSD-SSDSSNSSDSSDS 1138

Query: 642  NDNKEASQVN-SSDVSSEESKEGSSNSENSSDA-----NQNGSNSNENDNGNASHDANEN 695
            +D+ ++S  + SSD S       SS+S +SSD+     + + S+SNE+ + + S D++++
Sbjct: 1139 SDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDS 1198

Query: 696  ENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEE 750
             NS     S +  ++  + + ES+        ++ GS+S+++ +GS S+ S +++
Sbjct: 1199 SNSSDSSDSSDSSDSTSDSNDESDSQSKSGNGNNNGSDSDSDSEGSDSNHSTSDD 1253



 Score =  149 bits (377), Expect = 2e-34
 Identities = 160/704 (22%), Positives = 313/704 (43%), Gaps = 71/704 (10%)

Query: 105 DENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEG-E 163
           +  +  HK E    K  +  G   +       E   ++  NG    +E       H+G  
Sbjct: 70  ENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAE----TYGHDGIH 125

Query: 164 GSSENARTD-IESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQ 222
           G  EN   + I+ +  +      ++ + +  N     +N +      N++ A V E+  Q
Sbjct: 126 GKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQEDGPQ 185

Query: 223 QE-NEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVK 281
              +  + D E+E I+N   +   G       Q  ++    KE E      ED  AG   
Sbjct: 186 VAGSNNSTDNEDEIIENSCRNE--GNTSEITPQINSKRNGTKEAEVTPGTGED--AGLDN 241

Query: 282 EEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKD 341
            + S   N    D++ +E   + ED+EAG  K+  +  + +E +D   E+ + +      
Sbjct: 242 SDGSPSGNGA--DEDEDEGSGDDEDEEAGNGKDSSNNSKGQEGQDHGKEDDHDSSIGQNS 299

Query: 342 HVEENHEQDSKEEKE-ESNGTEAEKEEQGK--IQEEASSEKQVQDGEGNNEQHREENYAG 398
             +E ++ + KE+   E +G +  K E+    I E+  S++ ++D +  N  HRE     
Sbjct: 300 DSKEYYDPEGKEDPHNEVDGDKTSKSEENSAGIPEDNGSQR-IEDTQKLN--HRE----- 351

Query: 399 DNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTE--TNEVTDSNATTNIQE 456
              S  V+++   I  ES  +T  V K++    E++   SG    T EV   N     +E
Sbjct: 352 ---SKRVENR---ITKES--ETHAVGKSQDKGIEIKGPSSGNRNITKEVGKGNEG---KE 400

Query: 457 NGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNE 516
           + G++      G+ K        +   +++ P +    +   S  N +   S+  D ++ 
Sbjct: 401 DKGQHGMILGKGNVKTQGEVVNIEGPGQKSEPGNKVGHSNTGSDSNSDGYDSYDFDDKSM 460

Query: 517 TSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNG--------- 567
             +D NS  E +  D    ++ D+N+ + GD        +S NSD + +NG         
Sbjct: 461 QGDDPNSSDESNGNDDANSES-DNNSSSRGD--------ASYNSDESKDNGNGSDSKGAE 511

Query: 568 -AYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQND 626
               ++T+   N + NGN    G  D            SS+    +SSN+  ++DS  +D
Sbjct: 512 DDDSDSTSDTNNSDSNGNG-NNGNDDNDKSDSGKGKSDSSDSDSSDSSNSSDSSDSSDSD 570

Query: 627 NVNSDGSNTNSEGSANDNKEASQVNSSDVS----------SEESKEGSSNSENSSDANQN 676
           + +S+ S+++S+ S +D+ ++S  +SSD S          S +S + S +S++ SD++++
Sbjct: 571 SSDSN-SSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKS 629

Query: 677 GSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGS---N 733
            S+S+++D+ + S D+N +++S    +S++   +  ++S +S  + D S+ SD  S   +
Sbjct: 630 ESDSSDSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSSSSDS 689

Query: 734 SNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
           SN++D   SSD S + E  +S     +    +++S++ + S ++
Sbjct: 690 SNSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSD 733


>UniRef100_Q9T069 Hypothetical protein AT4g37820 [Arabidopsis thaliana]
          Length = 532

 Score =  194 bits (493), Expect = 8e-48
 Identities = 156/556 (28%), Positives = 264/556 (47%), Gaps = 58/556 (10%)

Query: 5   SPRRSQRSKGFKVKHALQICVLLGVCIWLVYQIKHTNEKKASYGESAKT-----GNDVVR 59
           +PRR QRSKG KVKH +Q+ +LLGV IWL+YQ+KH++EKKA +  ++K       N VV 
Sbjct: 4   TPRRGQRSKGIKVKHCIQLTLLLGVGIWLIYQMKHSHEKKAEFEGTSKIVVDDIDNTVVN 63

Query: 60  LGRKDLNPLVEETTVVDARHKEQDEE-SEHESKTEEQINLDEVNSVDENEPEHKP-EEEH 117
           LGRKDL P +EET   D + + +DEE S++E   +   + +  + + E E E K  EE +
Sbjct: 64  LGRKDLRPRIEETK--DVKDEVEDEEGSKNEGGGDVSTDKENGDEIVEREEEEKAVEENN 121

Query: 118 IKLDDANGVDE-NEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENAR--TDIE 174
            K  +  G +E NE  N  E    +D++ G +E S      + ++G+ +S      T+ +
Sbjct: 122 EKEAEGTGNEEGNEDSNNGESEKVVDESEGGNEISNEEAREINYKGDDASSEVMHGTEEK 181

Query: 175 SEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENE 234
           S + VE  GE   N  S EN S+ ++    K+E    E + + E         + D E +
Sbjct: 182 SNEKVEVEGESKSN--STENVSVHEDESGPKNEV--LEGSVIKEVSLNTTENGSDDGEQQ 237

Query: 235 EIKNEVEDTEAGEVKVEKSQQENEETK---DKENEEIKNEVEDKEAGEVKEEKSQQENEE 291
           E K+E+ D++ GE     S  E  ET        E  ++   D+     K    QQ   E
Sbjct: 238 ETKSEL-DSKTGEKGFSDSNGELPETNLSTSNATETTESSGSDESGSSGKSTGYQQTKNE 296

Query: 292 TKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDS 351
             +K                   EK +   EE+K KE+ +  ++ +  +D  +E   +  
Sbjct: 297 EDEK-------------------EKVQSSEEESKVKESGKNEKDASSSQDESKEEKPERK 337

Query: 352 KEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQD 411
           K+E+  S G   E+E + + +E++SS+++ ++ E  N++          ASS+   +  +
Sbjct: 338 KKEESSSQGEGKEEEPEKREKEDSSSQEESKEEEPENKE--------KEASSS--QEENE 387

Query: 412 IFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEK 471
           I      + E+    E NE++ E++K  +E+    ++N+   I++    + + T  G E+
Sbjct: 388 IKETEIKEKEESSSQEGNENK-ETEKKSSESQRKENTNSEKKIEQVESTDSSNTQKGDEQ 446

Query: 472 R---STSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSE----DANSK 524
           +   S  ESG     ++    S   E+      N N  T  T ++Q +T           
Sbjct: 447 KTDESKRESGNDTSNKETEDDSSKTESEKKEENNRNGETEETQNEQEQTKSALEISHTQD 506

Query: 525 VEDSSTD-TTTPKTED 539
           V+D+ TD  T P+T +
Sbjct: 507 VKDARTDLETLPETSN 522



 Score =  150 bits (380), Expect = 1e-34
 Identities = 131/515 (25%), Positives = 236/515 (45%), Gaps = 67/515 (13%)

Query: 284 KSQQENEETKDKENEEIKNEVEDKEAGEVKE--EKSRQENEETKDKENEEINQNGTDVKD 341
           + + E E T     ++I N V +    +++   E+++   +E +D+E  + N+ G DV  
Sbjct: 41  EKKAEFEGTSKIVVDDIDNTVVNLGRKDLRPRIEETKDVKDEVEDEEGSK-NEGGGDVST 99

Query: 342 HVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEAS-------SEKQVQDGEG----NNEQ 390
             E   E   +EE+E++     EKE +G   EE +       SEK V + EG    +NE+
Sbjct: 100 DKENGDEIVEREEEEKAVEENNEKEAEGTGNEEGNEDSNNGESEKVVDESEGGNEISNEE 159

Query: 391 HREENYAGDNASSAVDHKSQDIFNESY--------NKTEQVDKNEKNESEMESQKSGTET 442
            RE NY GD+ASS V H +++  NE          N TE V  +E           G+  
Sbjct: 160 AREINYKGDDASSEVMHGTEEKSNEKVEVEGESKSNSTENVSVHEDESGPKNEVLEGSVI 219

Query: 443 NEVTDSNATTNIQENG--GENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSS 500
            EV+  N T N  ++G   E +++ D+ + ++  S+S G+   E N  TS+  ET +SS 
Sbjct: 220 KEVS-LNTTENGSDDGEQQETKSELDSKTGEKGFSDSNGEL-PETNLSTSNATETTESSG 277

Query: 501 QNGNETTSHTTD-KQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
            + + ++  +T  +Q +  ED   KV+ S  ++   ++  +  DA+    +S  +     
Sbjct: 278 SDESGSSGKSTGYQQTKNEEDEKEKVQSSEEESKVKESGKNEKDASSSQDESKEEKPE-- 335

Query: 560 SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
                            + +    +S  EGK++   + +   S +  E K++E  N E  
Sbjct: 336 -----------------RKKKEESSSQGEGKEEEPEKREKEDSSSQEESKEEEPENKEKE 378

Query: 620 TDSVQNDN------VNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSD- 672
             S Q +N      +     +++ EG  N+NKE  +      SSE  ++ ++NSE   + 
Sbjct: 379 ASSSQEENEIKETEIKEKEESSSQEG--NENKETEK-----KSSESQRKENTNSEKKIEQ 431

Query: 673 -ANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEG 731
             + + SN+ + D         E+ N    K +E+D     +   ESEK ++ + + +  
Sbjct: 432 VESTDSSNTQKGDEQKTDESKRESGNDTSNKETEDD-----SSKTESEKKEENNRNGETE 486

Query: 732 SNSNTNDQGSSS-DPSITEEVKESHIDLGTLPESN 765
              N  +Q  S+ + S T++VK++  DL TLPE++
Sbjct: 487 ETQNEQEQTKSALEISHTQDVKDARTDLETLPETS 521



 Score =  123 bits (309), Expect = 2e-26
 Identities = 107/495 (21%), Positives = 216/495 (43%), Gaps = 52/495 (10%)

Query: 166 SENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQEN 225
           +++ + ++E E+  +  G    +T+ +  D +V+  EE K   EN E     E +     
Sbjct: 76  TKDVKDEVEDEEGSKNEGGGDVSTDKENGDEIVEREEEEKAVEENNEK----EAEGTGNE 131

Query: 226 EETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVK---E 282
           E  +D  N E +  V+++E G                       NE+ ++EA E+    +
Sbjct: 132 EGNEDSNNGESEKVVDESEGG-----------------------NEISNEEAREINYKGD 168

Query: 283 EKSQQENEETKDKENEEIKNEVEDK----EAGEVKEEKSRQENEETKDKENEEINQNGTD 338
           + S +    T++K NE+++ E E K    E   V E++S  +NE  +    +E++ N T+
Sbjct: 169 DASSEVMHGTEEKSNEKVEVEGESKSNSTENVSVHEDESGPKNEVLEGSVIKEVSLNTTE 228

Query: 339 VKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQE---EASSEKQVQDGEGNNEQHREEN 395
             +  ++  +Q++K E +   G +   +  G++ E     S+  +  +  G++E      
Sbjct: 229 --NGSDDGEQQETKSELDSKTGEKGFSDSNGELPETNLSTSNATETTESSGSDESGSSGK 286

Query: 396 YAG-DNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNI 454
             G     +  D K +   +E  +K ++  KNEK+ S   SQ    E          ++ 
Sbjct: 287 STGYQQTKNEEDEKEKVQSSEEESKVKESGKNEKDAS--SSQDESKEEKPERKKKEESSS 344

Query: 455 QENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNE-TTSHTTDK 513
           Q  G E +       EKR   +S  Q+  ++  P  +  E   SSSQ  NE   +   +K
Sbjct: 345 QGEGKEEE------PEKREKEDSSSQEESKEEEP--ENKEKEASSSQEENEIKETEIKEK 396

Query: 514 QNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETT 573
           +  +S++ N   E     + + + E++N++   + V+ST  S++   D    + + +E+ 
Sbjct: 397 EESSSQEGNENKETEKKSSESQRKENTNSEKKIEQVESTDSSNTQKGDEQKTDESKRESG 456

Query: 574 NLVQN-ENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDG 632
           N   N E  + +S  E ++   +       +T +EQ++ +S+   ++T  V++   + + 
Sbjct: 457 NDTSNKETEDDSSKTESEKKEENNRNGETEETQNEQEQTKSALEISHTQDVKDARTDLET 516

Query: 633 SNTNSEGSANDNKEA 647
               S G  +D   A
Sbjct: 517 LPETSNGLISDKVAA 531



 Score =  119 bits (297), Expect = 5e-25
 Identities = 128/527 (24%), Positives = 231/527 (43%), Gaps = 76/527 (14%)

Query: 198 VKENEENKHEAENKEAAEVHEEKSQQENEETKD-----KENEEIKNEVEDTEAGEVKVEK 252
           +K + E K E E      V +  +   N   KD     +E +++K+EVED E       K
Sbjct: 36  MKHSHEKKAEFEGTSKIVVDDIDNTVVNLGRKDLRPRIEETKDVKDEVEDEEGS-----K 90

Query: 253 SQQENEETKDKEN-EEIKNEVEDKEAGEVKEEK------SQQENEETKDKENEEIK---- 301
           ++   + + DKEN +EI    E+++A E   EK      +++ NE++ + E+E++     
Sbjct: 91  NEGGGDVSTDKENGDEIVEREEEEKAVEENNEKEAEGTGNEEGNEDSNNGESEKVVDESE 150

Query: 302 --NEVEDKEAGEVK---EEKSRQENEETKDKENEEINQNGTDVKDHVEEN---HEQDS-- 351
             NE+ ++EA E+    ++ S +    T++K NE++   G + K +  EN   HE +S  
Sbjct: 151 GGNEISNEEAREINYKGDDASSEVMHGTEEKSNEKVEVEG-ESKSNSTENVSVHEDESGP 209

Query: 352 KEE-------KEESNGTEAEKEEQGKIQEEASSEKQVQDGE----GNNEQHREENYAGDN 400
           K E       KE S  T     + G+ Q+E  SE   + GE     +N +  E N +  N
Sbjct: 210 KNEVLEGSVIKEVSLNTTENGSDDGE-QQETKSELDSKTGEKGFSDSNGELPETNLSTSN 268

Query: 401 ASSAVDHKSQDIFNESYNKTE-QVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGG 459
           A+   +    D    S   T  Q  KNE  E E E  +S  E ++V +S    N ++   
Sbjct: 269 ATETTESSGSDESGSSGKSTGYQQTKNE--EDEKEKVQSSEEESKVKESGK--NEKDASS 324

Query: 460 ENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSE 519
                 +   E++   ES  Q   ++  P     E  DSSSQ      S   + +N+  E
Sbjct: 325 SQDESKEEKPERKKKEESSSQGEGKEEEPEKR--EKEDSSSQE----ESKEEEPENKEKE 378

Query: 520 DANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNE 579
            ++S+ E+   +T   + E+S++    ++ ++  KSS      N N+        + Q E
Sbjct: 379 ASSSQEENEIKETEIKEKEESSSQEGNENKETEKKSSESQRKENTNS-----EKKIEQVE 433

Query: 580 NPNGNSVQEGKQDASHEAQLTASDTSSEQKKDES----SNAETNTDSVQNDNVNSDGSNT 635
           + + ++ Q+G +  + E+            K ES    SN ET  DS + ++   + +N 
Sbjct: 434 STDSSNTQKGDEQKTDES------------KRESGNDTSNKETEDDSSKTESEKKEENNR 481

Query: 636 NSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNE 682
           N E     N++    ++ ++S  +  + +     +     NG  S++
Sbjct: 482 NGETEETQNEQEQTKSALEISHTQDVKDARTDLETLPETSNGLISDK 528



 Score =  103 bits (258), Expect = 2e-20
 Identities = 108/476 (22%), Positives = 192/476 (39%), Gaps = 64/476 (13%)

Query: 307 KEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAE-- 364
           K + E K E          D +N  +N    D++  +EE   +D K+E E+  G++ E  
Sbjct: 37  KHSHEKKAEFEGTSKIVVDDIDNTVVNLGRKDLRPRIEET--KDVKDEVEDEEGSKNEGG 94

Query: 365 ------KEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYN 418
                 KE   +I E    EK V++   NNE+  E     +    + + +S+ + +ES  
Sbjct: 95  GDVSTDKENGDEIVEREEEEKAVEE---NNEKEAEGTGNEEGNEDSNNGESEKVVDESEG 151

Query: 419 KTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESG 478
             E +   E  E   +   + +E    T+  +   ++  G           E +S S   
Sbjct: 152 GNE-ISNEEAREINYKGDDASSEVMHGTEEKSNEKVEVEG-----------ESKSNSTEN 199

Query: 479 GQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTD-KQNETSEDANSKVED---SSTDTTT 534
              H++++ P ++ +E       + N T + + D +Q ET  + +SK  +   S ++   
Sbjct: 200 VSVHEDESGPKNEVLEGSVIKEVSLNTTENGSDDGEQQETKSELDSKTGEKGFSDSNGEL 259

Query: 535 PKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDAS 594
           P+T  S ++A     ++T  S S  S S+  +  Y++T N    +    +S +E K   S
Sbjct: 260 PETNLSTSNAT----ETTESSGSDESGSSGKSTGYQQTKNEEDEKEKVQSSEEESKVKES 315

Query: 595 HEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSD 654
            + +  AS +  E K+++    +             + S++  EG   + ++  + +SS 
Sbjct: 316 GKNEKDASSSQDESKEEKPERKK------------KEESSSQGEGKEEEPEKREKEDSS- 362

Query: 655 VSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENE-NSVQRKTSENDGEAAQN 713
            S EESKE                   EN    AS    ENE    + K  E       N
Sbjct: 363 -SQEESKE----------------EEPENKEKEASSSQEENEIKETEIKEKEESSSQEGN 405

Query: 714 ESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESN 769
           E+ E+EK   ES   +  ++    +Q  S+D S T++  E   D       N  SN
Sbjct: 406 ENKETEKKSSESQRKENTNSEKKIEQVESTDSSNTQKGDEQKTDESKRESGNDTSN 461



 Score = 92.0 bits (227), Expect = 6e-17
 Identities = 75/358 (20%), Positives = 149/358 (40%), Gaps = 25/358 (6%)

Query: 443 NEVTDSNATTNIQENGGENQAQTDNGSE------------KRSTSESGGQQHQEQNNPTS 490
           +EV D   + N  E GG+     +NG E            + +  E+ G  ++E N  ++
Sbjct: 81  DEVEDEEGSKN--EGGGDVSTDKENGDEIVEREEEEKAVEENNEKEAEGTGNEEGNEDSN 138

Query: 491 DGV-ETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTE-DSNADAAGDD 548
           +G  E V   S+ GNE ++    + N   +DA+S+V   + + +  K E +  + +   +
Sbjct: 139 NGESEKVVDESEGGNEISNEEAREINYKGDDASSEVMHGTEEKSNEKVEVEGESKSNSTE 198

Query: 549 VDSTYKSSSGNSDSNANNGAYKETT-NLVQNENPNGNSVQEGKQDASHEAQLTASDTSSE 607
             S ++  SG  +        KE + N  +N + +G   +   +  S   +   SD++ E
Sbjct: 199 NVSVHEDESGPKNEVLEGSVIKEVSLNTTENGSDDGEQQETKSELDSKTGEKGFSDSNGE 258

Query: 608 QKKDE--SSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSS 665
             +    +SNA   T+S  +D   S G +T  + + N+  E  +V SS+  S+  + G +
Sbjct: 259 LPETNLSTSNATETTESSGSDESGSSGKSTGYQQTKNEEDEKEKVQSSEEESKVKESGKN 318

Query: 666 NSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDES 725
             + SS  +++     E      S    E +     K  + D  + +    E  + K++ 
Sbjct: 319 EKDASSSQDESKEEKPERKKKEESSSQGEGKEEEPEKREKEDSSSQEESKEEEPENKEKE 378

Query: 726 AHSDEGSNS------NTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
           A S +  N          ++ SS + +  +E ++   +      +N+E     V S +
Sbjct: 379 ASSSQEENEIKETEIKEKEESSSQEGNENKETEKKSSESQRKENTNSEKKIEQVESTD 436



 Score = 79.7 bits (195), Expect = 3e-13
 Identities = 67/240 (27%), Positives = 118/240 (48%), Gaps = 15/240 (6%)

Query: 80  KEQDEESEHESKTEEQ-INLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEH 138
           KE+ + SE ESK +E   N  + +S  +   E KPE +  K ++++   E + E +PE+ 
Sbjct: 300 KEKVQSSEEESKVKESGKNEKDASSSQDESKEEKPERK--KKEESSSQGEGK-EEEPEKR 356

Query: 139 IKLDDANGVDENSEHSQDLVEHEGEGSSEN---ARTDI-ESEQHVEKVGEESDNTESKEN 194
            K +D++  +E+ E   +  E E   S E      T+I E E+   + G E+  TE K +
Sbjct: 357 EK-EDSSSQEESKEEEPENKEKEASSSQEENEIKETEIKEKEESSSQEGNENKETEKKSS 415

Query: 195 DSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEV--EDTEAGEVKVEK 252
           +S  KEN  ++ + E  E+ +     +Q+ +E+  D+   E  N+   ++TE    K E 
Sbjct: 416 ESQRKENTNSEKKIEQVESTD--SSNTQKGDEQKTDESKRESGNDTSNKETEDDSSKTE- 472

Query: 253 SQQENEETKDKENEEIKNEVED-KEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGE 311
           S+++ E  ++ E EE +NE E  K A E+   +  ++     +   E     + DK A E
Sbjct: 473 SEKKEENNRNGETEETQNEQEQTKSALEISHTQDVKDARTDLETLPETSNGLISDKVAAE 532


>UniRef100_Q9LH98 Arabidopsis thaliana genomic DNA, chromosome 3, BAC clone: T19N8
            [Arabidopsis thaliana]
          Length = 2081

 Score =  192 bits (489), Expect = 2e-47
 Identities = 180/761 (23%), Positives = 340/761 (44%), Gaps = 70/761 (9%)

Query: 48   GESAKTGNDVVRLGRKDLNPLVEETTVVDA---RHKEQDEESEHESKTEEQINLDEVNSV 104
            GES K   D  + G K+ N     T+       + K++ E      K +E+   + VN+ 
Sbjct: 911  GESVKYKKDEKKEGNKEENKDTINTSSKQKGKDKKKKKKESKNSNMKKKEEDKKEYVNNE 970

Query: 105  DENEPEHKPE---EEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHE 161
             + + ++K E    E+ KL + N  D  E +   +   K  +    +E    +++  + E
Sbjct: 971  LKKQEDNKKETTKSENSKLKEENK-DNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKE 1029

Query: 162  GEGSSENARTDIESEQHV-EKVGEESDNTESKENDSLVKENEENK-HEAENKEAAEVHEE 219
             + S +  R + +SE+   +K  EES + ++K+ +   KE +E++ H+++ KE  + HE+
Sbjct: 1030 KKKSQDKKREEKDSEERKSKKEKEESRDLKAKKKEEETKEKKESENHKSKKKEDKKEHED 1089

Query: 220  ----------KSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIK 269
                      K ++++EE+K ++ EE K ++E  E  +   +K + +NE+ K +  + +K
Sbjct: 1090 NKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLE-DQNSNKKKEDKNEKKKSQHVKLVK 1148

Query: 270  NEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKEN 329
             E + KE  E +E+   +E E +K ++NE  K E +  +  + K+EK  +E+EE K K+N
Sbjct: 1149 KESDKKEKKENEEKSETKEIESSKSQKNEVDKKEKKSSKDQQKKKEKEMKESEEKKLKKN 1208

Query: 330  EEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNE 389
            EE  +  T     VEEN +Q  KE K+E N  + +K+   K   ++  +K+  + E    
Sbjct: 1209 EEDRKKQTS----VEENKKQ--KETKKEKNKPKDDKKNTTK---QSGGKKESMESESKEA 1259

Query: 390  QHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSN 449
            ++++++ A   A S  D    +I  ++ ++ +       ++S+ +S +S  E     DS 
Sbjct: 1260 ENQQKSQATTQADS--DESKNEILMQADSQAD-----SHSDSQADSDESKNEILMQADSQ 1312

Query: 450  ATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSH 509
            ATT  Q N  E++ +  + +E +   E+     +E+N P  D   T   S        S 
Sbjct: 1313 ATT--QRNNEEDRKKQTSVAENKKQKET----KEEKNKPKDDKKNTTKQSGGKKESMESE 1366

Query: 510  TTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGD---DVDSTYKSSSGNSDSNA-- 564
            + + +N+    A ++ +   +        DS AD+  D   D D +       +DS A  
Sbjct: 1367 SKEAENQQKSQATTQADSDESKNEILMQADSQADSHSDSQADSDESKNEILMQADSQATT 1426

Query: 565  ---NNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTD 621
               N    K+ T++ +N+       ++ K     +     S    E  + ES  AE    
Sbjct: 1427 QRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDKKNTTEQSGGKKESMESESKEAENQQK 1486

Query: 622  SVQNDNVNSDGSNTN--SEGSANDNKEASQVNSSDVSSEE---SKEGSSNSENSSDANQN 676
            S       SD S      +  +  +  A+    SD S  E     +  ++S+  SD ++N
Sbjct: 1487 SQATTQGESDESKNEILMQADSQADTHANSQGDSDESKNEILMQADSQADSQTDSDESKN 1546

Query: 677  GSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNT 736
                  +   ++  D++E++N +     + D +A   ES+E  K K +  + DE    N 
Sbjct: 1547 EILMQADSQADSQTDSDESKNEI---LMQADSQAKIGESLEDNKVKGKEDNGDEVGKEN- 1602

Query: 737  NDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                     S T EVK  H +  +      E+  ++VS+ E
Sbjct: 1603 ---------SKTIEVKGRHEE--SKDGKTNENGGKEVSTEE 1632



 Score =  192 bits (488), Expect = 3e-47
 Identities = 189/814 (23%), Positives = 366/814 (44%), Gaps = 100/814 (12%)

Query: 42   EKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEV 101
            EKK    + +KT  +  +  +K  +   EE    + + K++ EES      +++   +E 
Sbjct: 1011 EKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEESRDLKAKKKE---EET 1067

Query: 102  NSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHE 161
                E+E  HK +++  K +  +     + E+K E+    +  +   E  +   + +E +
Sbjct: 1068 KEKKESE-NHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQ 1126

Query: 162  GEGSSENARTDIESEQHVEKVGEESDNTESKEND--SLVKENEENKHEAENKEAAEVHEE 219
                 +  + + +  QHV+ V +ESD  E KEN+  S  KE E +K +    +  E    
Sbjct: 1127 NSNKKKEDKNEKKKSQHVKLVKKESDKKEKKENEEKSETKEIESSKSQKNEVDKKEKKSS 1186

Query: 220  KSQQENEETKDKENEEIK---NEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVED-- 274
            K QQ+ +E + KE+EE K   NE +  +   V+  K Q+E ++ K+K  ++ KN  +   
Sbjct: 1187 KDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKEKNKPKDDKKNTTKQSG 1246

Query: 275  --KEA--GEVKEEKSQQENEETKDKENEEIKNEV---EDKEAGEVKEEKSRQENEETKDK 327
              KE+   E KE ++QQ+++ T   +++E KNE+    D +A    +  S+ +++E+K++
Sbjct: 1247 GKKESMESESKEAENQQKSQATTQADSDESKNEILMQADSQADSHSD--SQADSDESKNE 1304

Query: 328  ENEEINQNGTDVKDHVEENHEQDS-------KEEKEESNGTEAEKEEQGKIQEEASSEKQ 380
               + +   T  +++ E+  +Q S       KE KEE N  + +K+   K   ++  +K+
Sbjct: 1305 ILMQADSQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDKKNTTK---QSGGKKE 1361

Query: 381  VQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTE-----QVDKNE-KNESEME 434
              + E    ++++++ A   A S  D    +I  ++ ++ +     Q D +E KNE  M+
Sbjct: 1362 SMESESKEAENQQKSQATTQADS--DESKNEILMQADSQADSHSDSQADSDESKNEILMQ 1419

Query: 435  S-QKSGTETNEVTDSNATTNIQENGGENQAQTDNG----SEKRSTSESGGQ--------- 480
            +  ++ T+ N   D    T++ EN  + + + +       +K +T +SGG+         
Sbjct: 1420 ADSQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDKKNTTEQSGGKKESMESESK 1479

Query: 481  --QHQEQNNPTSDG---------VETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSS 529
              ++Q+++  T+ G         +   DS +     +   + + +NE    A+S+  DS 
Sbjct: 1480 EAENQQKSQATTQGESDESKNEILMQADSQADTHANSQGDSDESKNEILMQADSQA-DSQ 1538

Query: 530  TDTTTPKTE-----DSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGN 584
            TD+   K E     DS AD+  D  D +       +DS A  G   E  N V+ +  NG+
Sbjct: 1539 TDSDESKNEILMQADSQADSQTDS-DESKNEILMQADSQAKIGESLE-DNKVKGKEDNGD 1596

Query: 585  SVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDN--VNSDGSNTNSEGSAN 642
             V  GK+++         + S + K +E+   E +T+    D+  V  +G   +S    +
Sbjct: 1597 EV--GKENSKTIEVKGRHEESKDGKTNENGGKEVSTEEGSKDSNIVERNGGKEDSIKEGS 1654

Query: 643  DNKEASQVN----------SSDVSSEESKEGSSNSE---NSSDANQNGSNSNENDNGNAS 689
            ++ +  ++N          S D   EE KEG  NS    +  D  + G    EN    +S
Sbjct: 1655 EDGKTVEINGGEELSTEEGSKDGKIEEGKEGKENSTKEGSKDDKIEEGMEGKENSTKESS 1714

Query: 690  HDANENENSVQRKTSENDG-----------EAAQNESVESEKAKDESAHSDEGSNSNTND 738
             D   NE    ++ +  +G           ++  ++SVE    KD+S   D+  N + N+
Sbjct: 1715 KDGKINEIHGDKEATMEEGSKDGGTNSTGKDSKDSKSVEINGVKDDSL-KDDSKNGDINE 1773

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRD 772
              +  + S+ + V E   +  +L  S +   + D
Sbjct: 1774 INNGKEDSVKDNVTEIQGNDNSLTNSTSSEPNGD 1807



 Score =  180 bits (457), Expect = 1e-43
 Identities = 167/762 (21%), Positives = 351/762 (45%), Gaps = 76/762 (9%)

Query: 35   YQIKHTNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEE 94
            YQ     EK  + G     GN       KD   +  +    ++  K+++E   ++  + +
Sbjct: 834  YQSVEAKEKNENGGVDTNVGNKEDSKDLKDDRSVEVKANKEESMKKKREEVQRNDKSSTK 893

Query: 95   QINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHS 154
            ++  D  N++D +  +   E    K D+    + N+ ENK       D  N   +     
Sbjct: 894  EVR-DFANNMDIDVQKGSGESVKYKKDEKK--EGNKEENK-------DTINTSSKQKGKD 943

Query: 155  QDLVEHEGEGSSENARTDIESEQHVEKVGEESDN---TESKENDSLVKENEENKHEAENK 211
            +   + E + S+   + + + E    ++ ++ DN   T   EN  L +EN++NK + E++
Sbjct: 944  KKKKKKESKNSNMKKKEEDKKEYVNNELKKQEDNKKETTKSENSKLKEENKDNKEKKESE 1003

Query: 212  EAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNE 271
            ++A  + EK + E +++K KE              E K EK + ++++ ++K++EE K++
Sbjct: 1004 DSASKNREKKEYEEKKSKTKE--------------EAKKEKKKSQDKKREEKDSEERKSK 1049

Query: 272  VEDKEAGEVKEEKSQQENEETKDK---ENEEIKNEVEDKEAGEVKEEKSRQENEETKDKE 328
             E +E+ ++K +K +   EETK+K   EN + K + + KE  + K  K  ++ +E K  E
Sbjct: 1050 KEKEESRDLKAKKKE---EETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHE 1106

Query: 329  NEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNN 388
              +  +   D KD +E+  +Q+S ++KE+ N  E +K +  K+ ++ S +K+ ++ E  +
Sbjct: 1107 ESKSRKKEEDKKD-MEKLEDQNSNKKKEDKN--EKKKSQHVKLVKKESDKKEKKENEEKS 1163

Query: 389  EQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEM-ESQKSGTETNEVTD 447
            E    E+            KSQ    +   K    D+ +K E EM ES++   + NE  D
Sbjct: 1164 ETKEIES-----------SKSQKNEVDKKEKKSSKDQQKKKEKEMKESEEKKLKKNE-ED 1211

Query: 448  SNATTNIQENGGENQAQTDNG----SEKRSTSESGG-QQHQEQNNPTSDGVETVDSSSQN 502
                T+++EN  + + + +       +K +T +SGG ++  E  +  ++  +   +++Q 
Sbjct: 1212 RKKQTSVEENKKQKETKKEKNKPKDDKKNTTKQSGGKKESMESESKEAENQQKSQATTQA 1271

Query: 503  GNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTE-----DSNADAAGDDVDSTYKSSS 557
             ++ + +    Q ++  D++S   DS  D+   K E     DS A    ++ +   K +S
Sbjct: 1272 DSDESKNEILMQADSQADSHS---DSQADSDESKNEILMQADSQATTQRNNEEDRKKQTS 1328

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
                 N      KE  N  +++  N      GK+++       A +    Q   ++ + E
Sbjct: 1329 --VAENKKQKETKEEKNKPKDDKKNTTKQSGGKKESMESESKEAENQQKSQATTQADSDE 1386

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEA------SQVNSSDVSSEESKEGSSNSENSS 671
            +  + +   +  +D S+++S+  ++++K        SQ  +   + E+ K+ +S +EN  
Sbjct: 1387 SKNEILMQADSQAD-SHSDSQADSDESKNEILMQADSQATTQRNNEEDRKKQTSVAENKK 1445

Query: 672  D-ANQNGSNSNENDNGNASHDANENENSV--QRKTSENDGEAAQNESVESEKAKDE-SAH 727
                +   N  ++D  N +  +   + S+  + K +EN  ++      ES+++K+E    
Sbjct: 1446 QKETKEEKNKPKDDKKNTTEQSGGKKESMESESKEAENQQKSQATTQGESDESKNEILMQ 1505

Query: 728  SDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESN 769
            +D  ++++ N QG  SD S  E + ++     +  +S+   N
Sbjct: 1506 ADSQADTHANSQG-DSDESKNEILMQADSQADSQTDSDESKN 1546



 Score =  172 bits (436), Expect = 3e-41
 Identities = 176/808 (21%), Positives = 352/808 (42%), Gaps = 108/808 (13%)

Query: 38   KHTNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESE------HESK 91
            ++ N +  S G+S K   D     ++D+ P V+         KE+ +E++       E K
Sbjct: 499  ENVNIQGESIGDSTK---DNSLENKEDVKPKVDANESDGNSTKERHQEAQVNNGVSTEDK 555

Query: 92   TEEQINLDEVNSVDE------NEPEH-KPEEEHIKLDDANGVDENEVENKPEE-HIKLDD 143
              + I  DE    D+      N+ +H K + E  + ++   V    +ENK ++  +K D+
Sbjct: 556  NLDNIGADEQKKNDKSVEVTTNDGDHTKEKREETQGNNGESVKNENLENKEDKKELKDDE 615

Query: 144  ANGVDENSEHSQD-----------------LVEHEGEGSSENARTDIE-----SEQHVEK 181
            + G   N+E S +                 +V+++G  +  N   ++      ++ ++E 
Sbjct: 616  SVGAKTNNETSLEEKREQTQKGHDNSINSKIVDNKGGNADSNKEKEVHVGDSTNDNNMES 675

Query: 182  VGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVE 241
              +     E K+ND   ++ EE K    NK++ E  + ++++   ++KD ++ + K E  
Sbjct: 676  KEDTKSEVEVKKNDGSSEKGEEGKEN--NKDSMEDKKLENKESQTDSKDDKSVDDKQEEA 733

Query: 242  DTEAGEVKVEKS---------QQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQ-ENEE 291
                GE K +KS          +EN++TK  EN  ++N+ E+ +  + + EK ++ E +E
Sbjct: 734  QIYGGESKDDKSVEAKGKKKESKENKKTKTNENR-VRNKEENVQGNKKESEKVEKGEKKE 792

Query: 292  TKD------KENEEIKNEVEDKEAGEVKEEKSRQENEETKD---KENEEINQNG---TDV 339
            +KD      K+N+++ +     EA E   E ++++ EE+KD    E +E N+NG   T+V
Sbjct: 793  SKDAKSVETKDNKKLSSTENRDEAKERSGEDNKEDKEESKDYQSVEAKEKNENGGVDTNV 852

Query: 340  KDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQ-EEASSEKQVQDGEGNNE------QHR 392
             +  +    +D +  + ++N  E+ K+++ ++Q  + SS K+V+D   N +         
Sbjct: 853  GNKEDSKDLKDDRSVEVKANKEESMKKKREEVQRNDKSSTKEVRDFANNMDIDVQKGSGE 912

Query: 393  EENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATT 452
               Y  D        +++D  N S  +  +  K +K ES+  + K   E  +   +N   
Sbjct: 913  SVKYKKDEKKEGNKEENKDTINTSSKQKGKDKKKKKKESKNSNMKKKEEDKKEYVNN--- 969

Query: 453  NIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTD 512
                   E + Q DN   K+ T++S   + +E+N    +  E+ DS+S+N  +      +
Sbjct: 970  -------ELKKQEDN---KKETTKSENSKLKEENKDNKEKKESEDSASKNREK--KEYEE 1017

Query: 513  KQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKET 572
            K+++T E+A  + +         K++D   +    +   + K    + D  A     +ET
Sbjct: 1018 KKSKTKEEAKKEKK---------KSQDKKREEKDSEERKSKKEKEESRDLKAKK-KEEET 1067

Query: 573  TNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDG 632
                ++EN      ++ K+   +++     D   ++K +ES + +   D    + +    
Sbjct: 1068 KEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQN 1127

Query: 633  SNTNSEGSANDNKEASQVN--SSDVSSEESKEGSSNSE----NSSDANQNGSNSNENDNG 686
            SN   E   N+ K++  V     +   +E KE    SE     SS + +N  +  E  + 
Sbjct: 1128 SNKKKE-DKNEKKKSQHVKLVKKESDKKEKKENEEKSETKEIESSKSQKNEVDKKEKKSS 1186

Query: 687  NASHDANENE--NSVQRKTSENDGEAAQNESVESEKAKDES---AHSDEGSNSNTNDQGS 741
                   E E   S ++K  +N+ +  +  SVE  K + E+    +  +    NT  Q  
Sbjct: 1187 KDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKEKNKPKDDKKNTTKQSG 1246

Query: 742  SSDPSITEEVKESHIDLGTLPESNAESN 769
                S+  E KE+     +   + A+S+
Sbjct: 1247 GKKESMESESKEAENQQKSQATTQADSD 1274



 Score =  168 bits (425), Expect = 6e-40
 Identities = 162/760 (21%), Positives = 336/760 (43%), Gaps = 79/760 (10%)

Query: 43   KKASYGESAKTGNDVVRLGRKDLNPL--VEETTVVDARHKEQDEESEHESKTEEQINLDE 100
            +K   GE  K   D   +  KD   L   E       R  E ++E + ESK  + +   E
Sbjct: 783  EKVEKGEK-KESKDAKSVETKDNKKLSSTENRDEAKERSGEDNKEDKEESKDYQSVEAKE 841

Query: 101  VNS---VDENEPEHKPEEEHIKLDDANGVDENEVEN--KPEEHIKLDDANGVDENSE--H 153
             N    VD N   +K + + +K D +  V  N+ E+  K  E ++ +D +   E  +  +
Sbjct: 842  KNENGGVDTNVG-NKEDSKDLKDDRSVEVKANKEESMKKKREEVQRNDKSSTKEVRDFAN 900

Query: 154  SQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEA 213
            + D+   +G G S   + D + E + E+  +++ NT SK+     K+ ++ K E++N   
Sbjct: 901  NMDIDVQKGSGESVKYKKDEKKEGNKEE-NKDTINTSSKQKG---KDKKKKKKESKNSNM 956

Query: 214  AEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVE 273
             +  E+K +  N E K +E+    N+ E T++   K+++  ++N+E K+ E+   KN   
Sbjct: 957  KKKEEDKKEYVNNELKKQED----NKKETTKSENSKLKEENKDNKEKKESEDSASKN--- 1009

Query: 274  DKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEIN 333
                      + ++E EE K K  EE K E + K   + +EEK   ++EE K K+ +E  
Sbjct: 1010 ----------REKKEYEEKKSKTKEEAKKE-KKKSQDKKREEK---DSEERKSKKEKE-- 1053

Query: 334  QNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHRE 393
                + +D   +  E+++KE+KE  N    +KE++ + ++  S +K+       +++ ++
Sbjct: 1054 ----ESRDLKAKKKEEETKEKKESENHKSKKKEDKKEHEDNKSMKKE------EDKKEKK 1103

Query: 394  ENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESE----MESQKSGTETNEVTDSN 449
            ++    +     D K  +   +  +  ++ DKNEK +S+    ++ +    E  E  + +
Sbjct: 1104 KHEESKSRKKEEDKKDMEKLEDQNSNKKKEDKNEKKKSQHVKLVKKESDKKEKKENEEKS 1163

Query: 450  ATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSH 509
             T  I+     +++Q +   +K   S    Q+ +E+    S+  +   +      +T+  
Sbjct: 1164 ETKEIE----SSKSQKNEVDKKEKKSSKDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVE 1219

Query: 510  TTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKS---SSGNSDSNANN 566
               KQ ET ++ N   +D    T     +  + ++   + ++  KS   +  +SD + N 
Sbjct: 1220 ENKKQKETKKEKNKPKDDKKNTTKQSGGKKESMESESKEAENQQKSQATTQADSDESKNE 1279

Query: 567  GAYKETTNLVQNENPNGNSVQEGKQDASHEA--QLTASDTSSEQKKDESSNAETNTDSVQ 624
               +  +    + +   +S  E K +   +A  Q T    + E +K ++S AE       
Sbjct: 1280 ILMQADSQADSHSDSQADS-DESKNEILMQADSQATTQRNNEEDRKKQTSVAENKKQKET 1338

Query: 625  NDNVN---SDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQ--NGSN 679
             +  N    D  NT  +  +   KE+ +  S +  +++  + ++ +++    N+    ++
Sbjct: 1339 KEEKNKPKDDKKNTTKQ--SGGKKESMESESKEAENQQKSQATTQADSDESKNEILMQAD 1396

Query: 680  SNENDNGNASHDANENENSV------QRKTSENDGE--AAQNESVESEKAKD--ESAHSD 729
            S  + + ++  D++E++N +      Q  T  N+ E    Q    E++K K+  E  +  
Sbjct: 1397 SQADSHSDSQADSDESKNEILMQADSQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKP 1456

Query: 730  EGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESN 769
            +    NT +Q      S+  E KE+     +   +  ES+
Sbjct: 1457 KDDKKNTTEQSGGKKESMESESKEAENQQKSQATTQGESD 1496



 Score =  164 bits (416), Expect = 7e-39
 Identities = 177/805 (21%), Positives = 334/805 (40%), Gaps = 94/805 (11%)

Query: 33  LVYQIKHTNEKKASYGESAKTGNDVVRLGRK--DLNPLVEETT------VVDARHKEQDE 84
           +V ++K  +  +AS  ES+ T ++ V  G    + N    E+T      V  +   +   
Sbjct: 179 IVVEVKSKSSSEASSEESSSTEHNNVTTGSNMVETNGENSESTQEKGDGVEGSNGGDVSM 238

Query: 85  ESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD---DANGVDENEVENKPEEHI-- 139
           E+   +K E+   L E N+V EN    +   E+++ +   +  G  E+  ++  E+++  
Sbjct: 239 ENLQGNKVED---LKEGNNVVENGETKENNGENVESNNEKEVEGQGESIGDSAIEKNLES 295

Query: 140 KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
           K D  + V+        + E+ GE    N  + I++E+ VE  GE  ++++ ++N   ++
Sbjct: 296 KEDVKSEVEAAKNDGSSMTENLGEAQGNNGVSTIDNEKEVEGQGESIEDSDIEKN---LE 352

Query: 200 ENEENKHEAENKEAAEVH-----EEKSQQENEETKDKENEEIKNEVEDTEAGEVKV---- 250
             E+ K E E  + A        EE  +     T +  N E K   E T    V      
Sbjct: 353 SKEDVKSEVEAAKNAGSSMTGKLEEAQRNNGVSTNETMNSENKGSGESTNDKMVNATTND 412

Query: 251 EKSQQEN-EETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKD-----KENEEIKNEV 304
           E  ++EN EET +   E +K E  + +AG   EE  + EN E K      K N  ++ + 
Sbjct: 413 EDHKKENKEETHENNGESVKGENLENKAG--NEESMKGENLENKVGNEELKGNASVEAKT 470

Query: 305 EDKEAGEVKEEKSRQENEETKDKE---NEEINQNGTDVKDHVEENHEQDSKEEKEESNGT 361
            ++ + E K E+S++ NE   +KE    E +N  G  + D  ++N  ++ ++ K + +  
Sbjct: 471 NNESSKEEKREESQRSNEVYMNKETTKGENVNIQGESIGDSTKDNSLENKEDVKPKVDAN 530

Query: 362 EA------EKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNE 415
           E+      E+ ++ ++    S+E +  D  G +EQ + +  + +  ++  DH  +     
Sbjct: 531 ESDGNSTKERHQEAQVNNGVSTEDKNLDNIGADEQKKNDK-SVEVTTNDGDHTKEKREET 589

Query: 416 SYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTS 475
             N  E V KNE  E++ + ++   + +    +N  T+++E   + Q   DN    +   
Sbjct: 590 QGNNGESV-KNENLENKEDKKELKDDESVGAKTNNETSLEEKREQTQKGHDNSINSKIVD 648

Query: 476 ESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETS---------------ED 520
             GG     +      G  T D++ ++  +T S    K+N+ S               ED
Sbjct: 649 NKGGNADSNKEKEVHVGDSTNDNNMESKEDTKSEVEVKKNDGSSEKGEEGKENNKDSMED 708

Query: 521 ANSKVEDSSTDTTTPKTEDSNADAA----GDDVDSTYKSSSGNSDSNANNGAYKETTNLV 576
              + ++S TD+   K+ D   + A    G+  D     + G    +  N   K   N V
Sbjct: 709 KKLENKESQTDSKDDKSVDDKQEEAQIYGGESKDDKSVEAKGKKKESKENKKTKTNENRV 768

Query: 577 QN--ENPNGN-----SVQEGKQDASHEAQLT-------ASDTSSEQKKDESSNAETNTDS 622
           +N  EN  GN      V++G++  S +A+          S T +  +  E S  +   D 
Sbjct: 769 RNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNKEDK 828

Query: 623 VQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNE 682
            ++ +  S  +   +E    D    ++ +S D+  + S E  +N E S    +     N+
Sbjct: 829 EESKDYQSVEAKEKNENGGVDTNVGNKEDSKDLKDDRSVEVKANKEESMKKKREEVQRND 888

Query: 683 NDNGNASHD-ANENENSVQ---------RKTSENDGEAAQNESV----ESEKAKDESAHS 728
             +     D AN  +  VQ         +K  + +G   +N+        +K KD+    
Sbjct: 889 KSSTKEVRDFANNMDIDVQKGSGESVKYKKDEKKEGNKEENKDTINTSSKQKGKDKKKKK 948

Query: 729 DEGSNSNTNDQGSSSDPSITEEVKE 753
            E  NSN   +       +  E+K+
Sbjct: 949 KESKNSNMKKKEEDKKEYVNNELKK 973



 Score =  164 bits (415), Expect = 9e-39
 Identities = 171/816 (20%), Positives = 335/816 (40%), Gaps = 96/816 (11%)

Query: 39   HTNEKK----ASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKT-- 92
            HT EK+     + GES K  N   +  +K+L    +E+      ++   EE   +++   
Sbjct: 581  HTKEKREETQGNNGESVKNENLENKEDKKELKD--DESVGAKTNNETSLEEKREQTQKGH 638

Query: 93   EEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGV--DEN 150
            +  IN   V++   N   +K +E H+     +   E++ + K E  +K +D +    +E 
Sbjct: 639  DNSINSKIVDNKGGNADSNKEKEVHVGDSTNDNNMESKEDTKSEVEVKKNDGSSEKGEEG 698

Query: 151  SEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEES-----------------------D 187
             E+++D +E +   + E+ +TD + ++ V+   EE+                       +
Sbjct: 699  KENNKDSMEDKKLENKES-QTDSKDDKSVDDKQEEAQIYGGESKDDKSVEAKGKKKESKE 757

Query: 188  NTESKENDSLVKENEEN-KHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAG 246
            N ++K N++ V+  EEN +   +  E  E  E+K  ++ +  + K+N+++ +     EA 
Sbjct: 758  NKKTKTNENRVRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAK 817

Query: 247  EVKVEKSQQENEETKDKE------------------NEEIKNEVEDKEAGEVKEEKSQ-- 286
            E   E ++++ EE+KD +                  N+E   +++D  + EVK  K +  
Sbjct: 818  ERSGEDNKEDKEESKDYQSVEAKEKNENGGVDTNVGNKEDSKDLKDDRSVEVKANKEESM 877

Query: 287  -------QENEETKDKENEEIKNEVE---DKEAGEV----KEEKSRQENEETKDKENEEI 332
                   Q N+++  KE  +  N ++    K +GE     K+EK     EE KD  N   
Sbjct: 878  KKKREEVQRNDKSSTKEVRDFANNMDIDVQKGSGESVKYKKDEKKEGNKEENKDTINTSS 937

Query: 333  NQNGTDVKDHVEENHEQDSK---EEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNE 389
             Q G D K   +E+   + K   E+K+E    E +K+E  K +   S   ++++    N+
Sbjct: 938  KQKGKDKKKKKKESKNSNMKKKEEDKKEYVNNELKKQEDNKKETTKSENSKLKE---ENK 994

Query: 390  QHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEK--------NESEMESQKSGTE 441
             ++E+  + D+AS   + K    + E  +KT++  K EK         E + E +KS  E
Sbjct: 995  DNKEKKESEDSASKNREKKE---YEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKE 1051

Query: 442  TNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQ 501
              E  D  A    +E   + +++     +K    E    +  ++     +  +  +S S+
Sbjct: 1052 KEESRDLKAKKKEEETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSR 1111

Query: 502  NGNETTSH----TTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
               E             N+  ED N K + S       K  D       ++   T +  S
Sbjct: 1112 KKEEDKKDMEKLEDQNSNKKKEDKNEK-KKSQHVKLVKKESDKKEKKENEEKSETKEIES 1170

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
              S  N  +   K+++   Q +        E K+   +E       +  E KK + +  E
Sbjct: 1171 SKSQKNEVDKKEKKSSKDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKE 1230

Query: 618  TN--TDSVQNDNVNSDG--SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDA 673
             N   D  +N    S G   +  SE    +N++ SQ  +   S E   E    +++ +D+
Sbjct: 1231 KNKPKDDKKNTTKQSGGKKESMESESKEAENQQKSQATTQADSDESKNEILMQADSQADS 1290

Query: 674  NQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSN 733
            + + S ++ +++ N      +++ + QR   E+  +       + +K   E  +  +   
Sbjct: 1291 HSD-SQADSDESKNEILMQADSQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDK 1349

Query: 734  SNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESN 769
             NT  Q      S+  E KE+     +   + A+S+
Sbjct: 1350 KNTTKQSGGKKESMESESKEAENQQKSQATTQADSD 1385



 Score =  150 bits (380), Expect = 1e-34
 Identities = 154/763 (20%), Positives = 319/763 (41%), Gaps = 100/763 (13%)

Query: 38   KHTNEKKASYGESAKTGNDVVRLGRKDL-------NPLVEETTVVDARHKEQDEESEHES 90
            +++N+KK    E  K+ +  V+L +K+        N    ET  +++   +++E  + E 
Sbjct: 1126 QNSNKKKEDKNEKKKSQH--VKLVKKESDKKEKKENEEKSETKEIESSKSQKNEVDKKEK 1183

Query: 91   KT-EEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDE 149
            K+ ++Q    E    +  E + K  EE  K   +   ++ + E K E++   DD     +
Sbjct: 1184 KSSKDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKEKNKPKDDKKNTTK 1243

Query: 150  NSEHSQDLVEHEGEGSSEN----ARTDIESEQHVEKVGEESDNTESKENDSLVKENE--- 202
             S   ++ +E E + +       A T  +S++   ++  ++D+     +DS    +E   
Sbjct: 1244 QSGGKKESMESESKEAENQQKSQATTQADSDESKNEILMQADSQADSHSDSQADSDESKN 1303

Query: 203  ------------ENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVE------DTE 244
                        +  +E + K+   V E K Q+E +E K+K  ++ KN  +      ++ 
Sbjct: 1304 EILMQADSQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDKKNTTKQSGGKKESM 1363

Query: 245  AGEVKVEKSQQENEETKDKENEEIKNEV---EDKEAGEVKEEKSQQENEETKDK------ 295
              E K  ++QQ+++ T   +++E KNE+    D +A    +  SQ +++E+K++      
Sbjct: 1364 ESESKEAENQQKSQATTQADSDESKNEILMQADSQADSHSD--SQADSDESKNEILMQAD 1421

Query: 296  --ENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKE 353
                 +  NE + K+   V E K ++E +E K+K  ++  +N T+     +E+ E +SKE
Sbjct: 1422 SQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDD-KKNTTEQSGGKKESMESESKE 1480

Query: 354  EKEESNG---TEAEKEE-------QGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASS 403
             + +      T+ E +E       Q   Q +  +  Q    E  NE   + +   D+ + 
Sbjct: 1481 AENQQKSQATTQGESDESKNEILMQADSQADTHANSQGDSDESKNEILMQADSQADSQTD 1540

Query: 404  AVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENG---GE 460
            + + K++ +         Q D +E     +    S  +  E  + N     ++NG   G+
Sbjct: 1541 SDESKNEILMQADSQADSQTDSDESKNEILMQADSQAKIGESLEDNKVKGKEDNGDEVGK 1600

Query: 461  NQAQT------DNGSEKRSTSESGGQQ-HQEQNNPTSDGVE-------TVDSSSQNGNET 506
              ++T         S+   T+E+GG++   E+ +  S+ VE       ++   S++G   
Sbjct: 1601 ENSKTIEVKGRHEESKDGKTNENGGKEVSTEEGSKDSNIVERNGGKEDSIKEGSEDGKTV 1660

Query: 507  TSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANN 566
              +  ++ +      + K+E+          E S  D   + ++    S+  +S     N
Sbjct: 1661 EINGGEELSTEEGSKDGKIEEGKEGKENSTKEGSKDDKIEEGMEGKENSTKESSKDGKIN 1720

Query: 567  GAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNT------ 620
              + +    ++  + +G +   GK D+     +  +    +  KD+S N + N       
Sbjct: 1721 EIHGDKEATMEEGSKDGGTNSTGK-DSKDSKSVEINGVKDDSLKDDSKNGDINEINNGKE 1779

Query: 621  DSVQ--------NDNV---------NSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEG 663
            DSV+        NDN          N D  +TN +   N+  EA   ++ D ++ E++E 
Sbjct: 1780 DSVKDNVTEIQGNDNSLTNSTSSEPNGDKLDTNKDSMKNNTMEAQGGSNGDSTNGETEET 1839

Query: 664  SSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSEN 706
              ++ + ++ N     SNEN   N +    ++  S    T  N
Sbjct: 1840 KESNVSMNNQNMQDVGSNENSMNNQTTGTGDDIISTTTDTESN 1882



 Score =  146 bits (368), Expect = 3e-33
 Identities = 161/744 (21%), Positives = 311/744 (41%), Gaps = 70/744 (9%)

Query: 74  VVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKP--EEEHIKLDDANGVD---E 128
           VV+ + K   E S  ES + E  N+   +++ E   E+    +E+   ++ +NG D   E
Sbjct: 180 VVEVKSKSSSEASSEESSSTEHNNVTTGSNMVETNGENSESTQEKGDGVEGSNGGDVSME 239

Query: 129 NEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDN 188
           N   NK E+   L + N V EN E      E+ GE    N   ++E +   E +G     
Sbjct: 240 NLQGNKVED---LKEGNNVVENGETK----ENNGENVESNNEKEVEGQG--ESIG----- 285

Query: 189 TESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKEN--EEIKNEVEDTEAG 246
                 DS +++N E+K + +++  A  ++  S  EN       N    I NE E    G
Sbjct: 286 ------DSAIEKNLESKEDVKSEVEAAKNDGSSMTENLGEAQGNNGVSTIDNEKEVEGQG 339

Query: 247 EVKVEKSQQENEETKDKENEEIKNEVED-KEAGEV---KEEKSQQEN----EETKDKENE 298
           E   +   ++N E+K    E++K+EVE  K AG     K E++Q+ N     ET + EN+
Sbjct: 340 ESIEDSDIEKNLESK----EDVKSEVEAAKNAGSSMTGKLEEAQRNNGVSTNETMNSENK 395

Query: 299 EIKNEVEDK--EAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKE 356
                  DK   A    E+  ++  EET +   E +     + K   EE+ + ++ E K 
Sbjct: 396 GSGESTNDKMVNATTNDEDHKKENKEETHENNGESVKGENLENKAGNEESMKGENLENKV 455

Query: 357 ESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQH-REENYAGDNAS---SAVDHKSQDI 412
            +   +     + K   E+S E++ ++ + +NE +  +E   G+N +    ++   ++D 
Sbjct: 456 GNEELKGNASVEAKTNNESSKEEKREESQRSNEVYMNKETTKGENVNIQGESIGDSTKD- 514

Query: 413 FNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATT--NIQENGGENQAQTDNGSE 470
            N   NK +   K + NES+  S K   +  +V +  +T   N+   G + Q + D   E
Sbjct: 515 -NSLENKEDVKPKVDANESDGNSTKERHQEAQVNNGVSTEDKNLDNIGADEQKKNDKSVE 573

Query: 471 KRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDAN-SKVEDSS 529
              T+  G    +++     +  E+V + +    E      D ++  ++  N + +E+  
Sbjct: 574 V--TTNDGDHTKEKREETQGNNGESVKNENLENKEDKKELKDDESVGAKTNNETSLEEKR 631

Query: 530 TDTTTPKTEDSNA---DAAGDDVDSTYKSSSGNSDS-NANNGAYKETTNLVQNENPNGNS 585
             T        N+   D  G + DS  +      DS N NN   KE T        N  S
Sbjct: 632 EQTQKGHDNSINSKIVDNKGGNADSNKEKEVHVGDSTNDNNMESKEDTKSEVEVKKNDGS 691

Query: 586 VQEGKQ------DASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEG 639
            ++G++      D+  + +L   ++ ++ K D+S + +     +     + D  +  ++G
Sbjct: 692 SEKGEEGKENNKDSMEDKKLENKESQTDSKDDKSVDDKQEEAQIYGGE-SKDDKSVEAKG 750

Query: 640 SANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNEND------NGNASHDAN 693
              ++KE  +  +++      +E    ++  S+  + G      D        N    + 
Sbjct: 751 KKKESKENKKTKTNENRVRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSST 810

Query: 694 ENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKE 753
           EN +  + ++ E D +  + ES + +  + +  + + G ++N  ++  S D      V+ 
Sbjct: 811 ENRDEAKERSGE-DNKEDKEESKDYQSVEAKEKNENGGVDTNVGNKEDSKDLKDDRSVEV 869

Query: 754 SHIDLGTLPESNAESNHRDVSSAE 777
                 ++ +   E    D SS +
Sbjct: 870 KANKEESMKKKREEVQRNDKSSTK 893



 Score =  140 bits (352), Expect = 2e-31
 Identities = 160/744 (21%), Positives = 311/744 (41%), Gaps = 109/744 (14%)

Query: 42   EKKASYGESAKTGNDVVRLGRKDLNPLVEET---TVVDARHKEQDEESEHESKTEEQINL 98
            EKK+S  +  K   ++     K L    E+    T V+   K+++ + E     +++ N 
Sbjct: 1182 EKKSSKDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKEKNKPKDDKKNT 1241

Query: 99   DEVNS--VDENEPEHKPEEEHIKLDDANGVDENEVENK--PEEHIKLDDANGVDENSEHS 154
             + +    +  E E K  E   K       D +E +N+   +   + D  +    +S+ S
Sbjct: 1242 TKQSGGKKESMESESKEAENQQKSQATTQADSDESKNEILMQADSQADSHSDSQADSDES 1301

Query: 155  QDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEEN--KHEAENKE 212
            ++ +  + +  +   R + E  +    V E     E+KE  +  K++++N  K     KE
Sbjct: 1302 KNEILMQADSQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDKKNTTKQSGGKKE 1361

Query: 213  A--AEVHEEKSQQENEETKDKENEEIKNEV---EDTEA---GEVKVEKSQQENE---ETK 261
            +  +E  E ++QQ+++ T   +++E KNE+    D++A    + + +  + +NE   +  
Sbjct: 1362 SMESESKEAENQQKSQATTQADSDESKNEILMQADSQADSHSDSQADSDESKNEILMQAD 1421

Query: 262  DKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVED----KEA--GEVKEE 315
             +   +  NE + K+   V E K Q+E +E K+K  ++ KN  E     KE+   E KE 
Sbjct: 1422 SQATTQRNNEEDRKKQTSVAENKKQKETKEEKNKPKDDKKNTTEQSGGKKESMESESKEA 1481

Query: 316  KSRQENEETKDKENEEINQN---GTDVKDHVEENHEQDSKEEKEE----------SNGTE 362
            +++Q+++ T   E++E         D +     N + DS E K E          S    
Sbjct: 1482 ENQQKSQATTQGESDESKNEILMQADSQADTHANSQGDSDESKNEILMQADSQADSQTDS 1541

Query: 363  AEKEEQGKIQEEASSEKQVQDGEGNNE------------QHREENYAG---DNASSAVDH 407
             E + +  +Q ++ ++ Q    E  NE            +  E+N      DN       
Sbjct: 1542 DESKNEILMQADSQADSQTDSDESKNEILMQADSQAKIGESLEDNKVKGKEDNGDEVGKE 1601

Query: 408  KSQDI-------------FNESYNK---TEQVDKN----EKNESEMESQKSGTETNEVTD 447
             S+ I              NE+  K   TE+  K+    E+N  + +S K G+E  +  +
Sbjct: 1602 NSKTIEVKGRHEESKDGKTNENGGKEVSTEEGSKDSNIVERNGGKEDSIKEGSEDGKTVE 1661

Query: 448  SNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETT 507
             N    +    G    + + G E +  S   G     +++   +G+E  ++S++      
Sbjct: 1662 INGGEELSTEEGSKDGKIEEGKEGKENSTKEG----SKDDKIEEGMEGKENSTKE----- 1712

Query: 508  SHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDV----DSTYKSSSGNSDSN 563
            S    K NE   D  + +E+ S D  T  T   + D+   ++    D + K  S N D N
Sbjct: 1713 SSKDGKINEIHGDKEATMEEGSKDGGTNSTGKDSKDSKSVEINGVKDDSLKDDSKNGDIN 1772

Query: 564  -ANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDS 622
              NNG      + V     N NS+               + TSSE   D+    +TN DS
Sbjct: 1773 EINNGKEDSVKDNVTEIQGNDNSL--------------TNSTSSEPNGDK---LDTNKDS 1815

Query: 623  VQNDNVNSDGSNT--NSEGSANDNKEAS-QVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            ++N+ + + G +   ++ G   + KE++  +N+ ++    S E S N++ +   +   S 
Sbjct: 1816 MKNNTMEAQGGSNGDSTNGETEETKESNVSMNNQNMQDVGSNENSMNNQTTGTGDDIIST 1875

Query: 680  SNENDNGNASHDANENENSVQRKT 703
            + + ++ N S +     ++++ K+
Sbjct: 1876 TTDTES-NTSKEVTSFISNLEEKS 1898



 Score = 71.2 bits (173), Expect = 1e-10
 Identities = 95/406 (23%), Positives = 155/406 (37%), Gaps = 51/406 (12%)

Query: 393 EENYAGDNASSAVDHKSQDIFNESYNKTEQ---------VDKNEKNESEMESQKSG-TET 442
           E++  GD A S +  + ++    S  + EQ         V+   K+ SE  S++S  TE 
Sbjct: 143 EKHIKGDEAMS-LSLEQKNAVETSITQWEQTITRIVKIVVEVKSKSSSEASSEESSSTEH 201

Query: 443 NEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQN 502
           N VT  +   N+ E  GEN   T    +    S  G    +       + ++  ++  +N
Sbjct: 202 NNVTTGS---NMVETNGENSESTQEKGDGVEGSNGGDVSMENLQGNKVEDLKEGNNVVEN 258

Query: 503 GN--ETTSHTTDKQNETS-EDANSKVEDSSTDTTTPKTED--SNADAAGDDVDSTYKSSS 557
           G   E      +  NE   E     + DS+ +      ED  S  +AA +D  S  ++  
Sbjct: 259 GETKENNGENVESNNEKEVEGQGESIGDSAIEKNLESKEDVKSEVEAAKNDGSSMTENLG 318

Query: 558 GNSDSNANNGAYKETTNLVQNENPNGNSVQ---EGKQDASHEAQLTASDTSSEQKKDESS 614
               +N  +    E     Q E+   + ++   E K+D   E +   +  SS   K E  
Sbjct: 319 EAQGNNGVSTIDNEKEVEGQGESIEDSDIEKNLESKEDVKSEVEAAKNAGSSMTGKLEE- 377

Query: 615 NAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDAN 674
            A+ N     N+ +NS+  N  S  S ND    +  N  D             EN  + +
Sbjct: 378 -AQRNNGVSTNETMNSE--NKGSGESTNDKMVNATTNDED----------HKKENKEETH 424

Query: 675 QNGSNSNENDN-----GNASHDANEN-ENSVQRKTSENDG--EAAQNESVESEKAKDESA 726
           +N   S + +N     GN      EN EN V  +  + +   EA  N     E+ ++ES 
Sbjct: 425 ENNGESVKGENLENKAGNEESMKGENLENKVGNEELKGNASVEAKTNNESSKEEKREESQ 484

Query: 727 HSDE-------GSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESN 765
            S+E           N N QG S   S  +   E+  D+    ++N
Sbjct: 485 RSNEVYMNKETTKGENVNIQGESIGDSTKDNSLENKEDVKPKVDAN 530



 Score = 63.9 bits (154), Expect = 2e-08
 Identities = 75/341 (21%), Positives = 137/341 (39%), Gaps = 34/341 (9%)

Query: 76   DARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKP 135
            D++ K  +   +++ K +E  N DEV   +    E K   E  K    N     EV  + 
Sbjct: 1574 DSQAKIGESLEDNKVKGKED-NGDEVGKENSKTIEVKGRHEESKDGKTNENGGKEVSTEE 1632

Query: 136  -EEHIKLDDANGVDENS--EHSQDLVEHEGEGSSENARTDIESEQHVE--KVGEESDNTE 190
              +   + + NG  E+S  E S+D    E  G  E +  +   +  +E  K G+E+   E
Sbjct: 1633 GSKDSNIVERNGGKEDSIKEGSEDGKTVEINGGEELSTEEGSKDGKIEEGKEGKENSTKE 1692

Query: 191  SKENDSLVK--ENEENKHEAENKEAA--EVHEEKSQQENEETKDKENEEIKNEVEDTEAG 246
              ++D + +  E +EN  +  +K+    E+H +K     E +KD        + +D+++ 
Sbjct: 1693 GSKDDKIEEGMEGKENSTKESSKDGKINEIHGDKEATMEEGSKDGGTNSTGKDSKDSKSV 1752

Query: 247  EVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKE----------EKSQQENEETKDKE 296
            E+   K     +++K+ +  EI N  ED     V E            S + N +  D  
Sbjct: 1753 EINGVKDDSLKDDSKNGDINEINNGKEDSVKDNVTEIQGNDNSLTNSTSSEPNGDKLDTN 1812

Query: 297  NEEIKNEVEDKEAG-----------EVKEEK---SRQENEETKDKENEEINQNGTDVKDH 342
             + +KN   + + G           E KE     + Q  ++    EN   NQ      D 
Sbjct: 1813 KDSMKNNTMEAQGGSNGDSTNGETEETKESNVSMNNQNMQDVGSNENSMNNQTTGTGDDI 1872

Query: 343  VEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQD 383
            +    + +S   KE ++     +E+    QE  S  ++++D
Sbjct: 1873 ISTTTDTESNTSKEVTSFISNLEEKSPGTQEFQSFFQKLKD 1913


>UniRef100_Q9DGL1 Retinitis pigmentosa GTPase regulator-like protein [Fugu rubripes]
          Length = 791

 Score =  191 bits (484), Expect = 9e-47
 Identities = 128/494 (25%), Positives = 243/494 (48%), Gaps = 29/494 (5%)

Query: 49  ESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENE 108
           E ++  ++ V    +D    ++ T   +   +E++E+ + E KT   ++ +E  +V ++ 
Sbjct: 284 EGSQDKSESVTANEEDEKESIQGTEEEEEEEEEEEEDQKEEQKTSADVSEEEEENVTQSS 343

Query: 109 PEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSEN 168
            +   EE+    D  +  DE++ + + EE           E+    Q+  E E E   E 
Sbjct: 344 DKASDEEKEGDSDTLHPEDESQSDVEDEEE---------GESRSEGQEEEEEEEEEEEER 394

Query: 169 ARTDIESEQHVEKVGEESD-NTESKENDSLVKENEENK-HEAENKEAAEVHEEKSQQENE 226
           + T  ESE   EK GE  + + E +E +S V+E+EE   HE+E K+A+E  EE  ++E +
Sbjct: 395 SST-AESESEDEKKGERKERDVEEEEGESEVEESEEGSDHESERKKASESEEEGEEEEAD 453

Query: 227 ETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKE---NEEIKNEVEDKEAGEVKEE 283
              ++E  + K++ E+++A      +  +E + + +KE   NEE ++  E +E+ E  EE
Sbjct: 454 SLSEEEEGDSKSDAEESDAESETEGEGAEEEQSSTEKEGESNEEEQSSTEKEESNE--EE 511

Query: 284 KSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHV 343
           +S  E EE+ ++E    + E E  E  +   EK     EE    E EE +          
Sbjct: 512 QSSTEKEESNEEEQSSTEKEGESNEEEQSSTEKEESNEEEQSSTEKEEESNEEEQSSTEK 571

Query: 344 EENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASS 403
           EE++E++ +EE+ ESN  E+E+E+Q   +EE + E+  ++ E + EQ++EE  A +    
Sbjct: 572 EESNEEEEEEEESESNEEESEEEDQKDEEEEETGEEDEEEEEESEEQNQEEE-AEEEEDG 630

Query: 404 AVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQA 463
             D + ++   E   +TE+ +++E+ E+E E +    ET+ V +       +E+  EN+ 
Sbjct: 631 ETDVQEEE---EEEEETEKEEEDEEEETEKEEEDEEEETDRVEE-------EEDAEENEE 680

Query: 464 QTDNGSEKRSTSESGGQQHQ-EQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDAN 522
           + +  S      ES G++ + E+++   D  E  +S  + G E+ S   + +   SE+  
Sbjct: 681 EEEEESNSEEDEESDGEEEEDEESDSEEDEEEESESEEEEGEESESEEEEGEESESEEEE 740

Query: 523 SKVEDSSTDTTTPK 536
            +  D   +    K
Sbjct: 741 GEESDREEEEEIKK 754



 Score =  174 bits (440), Expect = 1e-41
 Identities = 128/444 (28%), Positives = 216/444 (47%), Gaps = 33/444 (7%)

Query: 40  TNEKKASYGESAKTGNDVVRLGRKD-LNPL------VEETTVVDARHKEQDEESEHESKT 92
           + E++ +  +S+   +D  + G  D L+P       VE+    ++R + Q+EE E E + 
Sbjct: 332 SEEEEENVTQSSDKASDEEKEGDSDTLHPEDESQSDVEDEEEGESRSEGQEEEEEEEEEE 391

Query: 93  EEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSE 152
           EE+ +  E  S DE + E K  +   +  ++   +  E  +   E  K  ++    E  E
Sbjct: 392 EERSSTAESESEDEKKGERKERDVEEEEGESEVEESEEGSDHESERKKASESEEEGEEEE 451

Query: 153 HSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKE 212
                 E EG+  S+   +D ESE   E   EE  +TE KE +S    NEE +   E +E
Sbjct: 452 ADSLSEEEEGDSKSDAEESDAESETEGEGAEEEQSSTE-KEGES----NEEEQSSTEKEE 506

Query: 213 AAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEV 272
           + E  EE+S  E EE+ ++E    + E E  E  +   EK +   EE    E EE  NE 
Sbjct: 507 SNE--EEQSSTEKEESNEEEQSSTEKEGESNEEEQSSTEKEESNEEEQSSTEKEEESNEE 564

Query: 273 EDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEI 332
           E  ++   KEE +++E EE + + NEE   E + K+    +EE+   E +E +++E+EE 
Sbjct: 565 E--QSSTEKEESNEEEEEEEESESNEEESEEEDQKD----EEEEETGEEDEEEEEESEEQ 618

Query: 333 NQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHR 392
           NQ   + +   EE+ E D +EE+EE   TE E+E+     EE  +EK+ +D E   ++  
Sbjct: 619 NQ---EEEAEEEEDGETDVQEEEEEEEETEKEEED-----EEEETEKEEEDEEEETDRVE 670

Query: 393 EENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATT 452
           EE  A +N     +  + +   ES  + E+ ++++  E E E  +S  E  E ++S    
Sbjct: 671 EEEDAEENEEEEEEESNSEEDEESDGEEEEDEESDSEEDEEEESESEEEEGEESESE--- 727

Query: 453 NIQENGGENQAQTDNGSEKRSTSE 476
             +E G E++++ + G E     E
Sbjct: 728 --EEEGEESESEEEEGEESDREEE 749



 Score =  173 bits (438), Expect = 2e-41
 Identities = 148/723 (20%), Positives = 302/723 (41%), Gaps = 81/723 (11%)

Query: 44  KASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNS 103
           +A+  ESA      V+  R     +V  +  + +  K  D    H S   + +N +   S
Sbjct: 114 EAAASESAAAKVKQVQQKRAKSKVIVVRSAGLSSPAKATDSPGFHLS---DALNEERTKS 170

Query: 104 VDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANG---VDENSEHSQDLVEH 160
            +  +    P   H      N  ++  ++++ +   K + +N        S  +   + H
Sbjct: 171 TEREKQPDAPRIIHTSKKSKNDKNKRVLQDRKQPEEKQETSNVSLLAGAASVAAAAALMH 230

Query: 161 EGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEK 220
           EG G    + +  E  Q V +   E              E+E +     NK A  ++ + 
Sbjct: 231 EGSGRLFKSSSPSEDSQSVLRAQSE--------------ESEAHGASFSNKSAVSINIQP 276

Query: 221 --SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAG 278
             S  E E ++DK      NE ++ E+    ++ +++E EE +++E ++ + +    +  
Sbjct: 277 PASPSETEGSQDKSESVTANEEDEKES----IQGTEEEEEEEEEEEEDQKEEQKTSADVS 332

Query: 279 EVKEEKSQQENEETKDKENE----------EIKNEVEDKEAGEVKEEKSRQENEETKDKE 328
           E +EE   Q +++  D+E E          E +++VED+E GE + E   +E EE +++E
Sbjct: 333 EEEEENVTQSSDKASDEEKEGDSDTLHPEDESQSDVEDEEEGESRSEGQEEEEEEEEEEE 392

Query: 329 NEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNN 388
                       +   E  E+D +EE+ ES   E+E+    + + + +SE + ++GE   
Sbjct: 393 ERSSTAESESEDEKKGERKERDVEEEEGESEVEESEEGSDHESERKKASESE-EEGEEEE 451

Query: 389 EQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDS 448
                E   GD+ S A +           +  E   + E  E E  S +   E+NE  + 
Sbjct: 452 ADSLSEEEEGDSKSDAEE-----------SDAESETEGEGAEEEQSSTEKEGESNE--EE 498

Query: 449 NATTNIQENGGENQAQT---DNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNE 505
            ++T  +E+  E Q+ T   ++  E++S++E  G+ ++E+ + T           +  NE
Sbjct: 499 QSSTEKEESNEEEQSSTEKEESNEEEQSSTEKEGESNEEEQSST---------EKEESNE 549

Query: 506 TTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNA---DAAGDDVDSTYKSSSGNSDS 562
               +T+K+ E++E+  S  E   ++    + E+S +   ++  +D     +  +G  D 
Sbjct: 550 EEQSSTEKEEESNEEEQSSTEKEESNEEEEEEEESESNEEESEEEDQKDEEEEETGEEDE 609

Query: 563 NANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDS 622
                  +E  +  QN+       ++G+ D   E +        E+ ++E +  E   + 
Sbjct: 610 E------EEEESEEQNQEEEAEEEEDGETDVQEEEEEEEETEKEEEDEEEETEKEEEDEE 663

Query: 623 VQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNE 682
            + D V         E  A +N+E  +  S+    EES +G    +  SD+ ++    +E
Sbjct: 664 EETDRV-------EEEEDAEENEEEEEEESNSEEDEES-DGEEEEDEESDSEEDEEEESE 715

Query: 683 NDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSS 742
           ++        +E E   + ++ E +GE +  E  E E+ K +      G    +  +G +
Sbjct: 716 SEEEEGEESESEEEEGEESESEEEEGEESDRE--EEEEIKKKKRPVKLGRQHRSGVKGQA 773

Query: 743 SDP 745
           ++P
Sbjct: 774 AEP 776



 Score =  172 bits (437), Expect = 3e-41
 Identities = 120/455 (26%), Positives = 210/455 (45%), Gaps = 33/455 (7%)

Query: 42  EKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEV 101
           E++    E  KT  DV            EE  V  +  K  DEE E +S T    +  + 
Sbjct: 316 EEEEDQKEEQKTSADVSE---------EEEENVTQSSDKASDEEKEGDSDTLHPEDESQS 366

Query: 102 NSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENS--EHSQDLVE 159
           +  DE E E + E +          +E E E + EE     ++   DE       +D+ E
Sbjct: 367 DVEDEEEGESRSEGQE---------EEEEEEEEEEERSSTAESESEDEKKGERKERDVEE 417

Query: 160 HEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENE-ENKHEAENKEAAEVHE 218
            EGE   E +    + E   +K  E  +  E +E DSL +E E ++K +AE  +A    E
Sbjct: 418 EEGESEVEESEEGSDHESERKKASESEEEGEEEEADSLSEEEEGDSKSDAEESDAESETE 477

Query: 219 EKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAG 278
            +  +E + + +KE E  + E   TE    K E +++E   T+ +E+ E +    +KE  
Sbjct: 478 GEGAEEEQSSTEKEGESNEEEQSSTE----KEESNEEEQSSTEKEESNEEEQSSTEKEGE 533

Query: 279 EVKEEKSQQENEETKDKENEEIKNEVE--DKEAGEVKEEKSRQENEETKDKENEEINQNG 336
             +EE+S  E EE+ ++E    + E E  ++E    ++E+S +E EE ++ E+ E     
Sbjct: 534 SNEEEQSSTEKEESNEEEQSSTEKEEESNEEEQSSTEKEESNEEEEEEEESESNEEESEE 593

Query: 337 TDVKDHVEENHEQDSKEEKEES----NGTEAEKEEQGK--IQEEASSEKQVQDGEGNNEQ 390
            D KD  EE   ++ +EE+EES       EAE+EE G+  +QEE   E++ +  E + E+
Sbjct: 594 EDQKDEEEEETGEEDEEEEEESEEQNQEEEAEEEEDGETDVQEEEEEEEETEKEEEDEEE 653

Query: 391 HREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNA 450
             E+    +   +    + +D       + E+ +  E  ES+ E ++     +E  +   
Sbjct: 654 ETEKEEEDEEEETDRVEEEEDAEENEEEEEEESNSEEDEESDGEEEEDEESDSEEDEEEE 713

Query: 451 TTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQ 485
           + + +E G E++++ + G E  S  E G +  +E+
Sbjct: 714 SESEEEEGEESESEEEEGEESESEEEEGEESDREE 748



 Score =  170 bits (430), Expect = 2e-40
 Identities = 158/728 (21%), Positives = 312/728 (42%), Gaps = 70/728 (9%)

Query: 78  RHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDD----------ANGVD 127
           RH           KT  Q   + + +V++ +  H+  + H++ D+          A G  
Sbjct: 45  RHHSSRSLGSQRQKTSGQNKENLILAVEQLQRIHRKNKTHVENDEKADSQQQLRPAEGKQ 104

Query: 128 E-NEVENKPEEHIKLDDA---NGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVG 183
           +  EV  +PE       A     V +    S+ +V      SS    TD       + + 
Sbjct: 105 QLTEVGRRPEAAASESAAAKVKQVQQKRAKSKVIVVRSAGLSSPAKATDSPGFHLSDALN 164

Query: 184 EE-SDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVED 242
           EE + +TE ++     +    +K    +K    + + K  +E +ET +         V  
Sbjct: 165 EERTKSTEREKQPDAPRIIHTSKKSKNDKNKRVLQDRKQPEEKQETSNVSLLAGAASVAA 224

Query: 243 TEA----GEVKVEKSQQENEETKD------KENEEIKNEVEDKEAGEVKEEK--SQQENE 290
             A    G  ++ KS   +E+++       +E+E       +K A  +  +   S  E E
Sbjct: 225 AAALMHEGSGRLFKSSSPSEDSQSVLRAQSEESEAHGASFSNKSAVSINIQPPASPSETE 284

Query: 291 ETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQD 350
            ++DK      NE ++KE+ +  EE+  +E EE +D++ E+  +   DV +  EEN  Q 
Sbjct: 285 GSQDKSESVTANEEDEKESIQGTEEEEEEEEEEEEDQKEEQ--KTSADVSEEEEENVTQS 342

Query: 351 ----SKEEKE-ESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAV 405
               S EEKE +S+    E E Q  +++E   E + +  E   E+  EE      A S  
Sbjct: 343 SDKASDEEKEGDSDTLHPEDESQSDVEDEEEGESRSEGQEEEEEEEEEEEERSSTAESES 402

Query: 406 ------DHKSQDI-FNESYNKTEQVDKNEKNESE----MESQKSGTE-----TNEVTDSN 449
                 + K +D+   E  ++ E+ ++   +ESE     ES++ G E      +E  + +
Sbjct: 403 EDEKKGERKERDVEEEEGESEVEESEEGSDHESERKKASESEEEGEEEEADSLSEEEEGD 462

Query: 450 ATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT----SDGVETVDSSSQNGNE 505
           + ++ +E+  E++ + +   E++S++E  G+ ++E+ + T    S+  E   +  +  NE
Sbjct: 463 SKSDAEESDAESETEGEGAEEEQSSTEKEGESNEEEQSSTEKEESNEEEQSSTEKEESNE 522

Query: 506 TTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNAN 565
               +T+K+ E++E+     E SST+      E+ ++    ++ +   +SS+   +SN  
Sbjct: 523 EEQSSTEKEGESNEE-----EQSSTEKEESNEEEQSSTEKEEESNEEEQSSTEKEESN-- 575

Query: 566 NGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQN 625
               +E     ++E+    S +E ++D   E + T  +   E+++ E  N E   +  + 
Sbjct: 576 ----EEEEEEEESESNEEESEEEDQKD--EEEEETGEEDEEEEEESEEQNQEEEAE--EE 627

Query: 626 DNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDN 685
           ++  +D      E    + +E  +   ++   E+ +E +   E   DA +N     E  N
Sbjct: 628 EDGETDVQEEEEEEEETEKEEEDEEEETEKEEEDEEEETDRVEEEEDAEENEEEEEEESN 687

Query: 686 GNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDP 745
                +++  E   +   SE D E  ++ES E E  + ES   +   + +  ++G  SD 
Sbjct: 688 SEEDEESDGEEEEDEESDSEED-EEEESESEEEEGEESESEEEEGEESESEEEEGEESDR 746

Query: 746 SITEEVKE 753
              EE+K+
Sbjct: 747 EEEEEIKK 754



 Score =  162 bits (411), Expect = 3e-38
 Identities = 159/745 (21%), Positives = 317/745 (42%), Gaps = 89/745 (11%)

Query: 31  IWLVYQIKHTNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHES 90
           I  V Q++  + K  ++ E     ND     ++ L P   +  + +   + +   SE  +
Sbjct: 68  ILAVEQLQRIHRKNKTHVE-----NDEKADSQQQLRPAEGKQQLTEVGRRPEAAASESAA 122

Query: 91  KTEEQINLDE-------VNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDD 143
              +Q+           V S   + P    +     L DA     NE   K  E  K  D
Sbjct: 123 AKVKQVQQKRAKSKVIVVRSAGLSSPAKATDSPGFHLSDAL----NEERTKSTEREKQPD 178

Query: 144 ANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEE 203
           A  +   S+ S++          +N R   + +Q  EK  +E+ N       + V     
Sbjct: 179 APRIIHTSKKSKN---------DKNKRVLQDRKQPEEK--QETSNVSLLAGAASVAAAAA 227

Query: 204 NKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEK--SQQENEETK 261
             HE   +        +  Q     + +E+E       +  A  + ++   S  E E ++
Sbjct: 228 LMHEGSGRLFKSSSPSEDSQSVLRAQSEESEAHGASFSNKSAVSINIQPPASPSETEGSQ 287

Query: 262 DKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQEN 321
           DK      NE ++KE+ +  EE+ ++E EE +D++ E+       K + +V EE+  +EN
Sbjct: 288 DKSESVTANEEDEKESIQGTEEEEEEEEEEEEDQKEEQ-------KTSADVSEEE--EEN 338

Query: 322 -EETKDKENEEINQNGTDVKDHVEENHEQDSKEEKE---ESNGTEAEKEEQGKIQEEASS 377
             ++ DK ++E  +  +D   H E+  + D ++E+E    S G E E+EE+ + +E +S+
Sbjct: 339 VTQSSDKASDEEKEGDSDTL-HPEDESQSDVEDEEEGESRSEGQEEEEEEEEEEEERSST 397

Query: 378 EKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQK 437
            +   + E   E+ +E +   +   S V+   +   +ES  K     + E  E E +S  
Sbjct: 398 AESESEDEKKGER-KERDVEEEEGESEVEESEEGSDHESERKKASESEEEGEEEEADS-- 454

Query: 438 SGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT----SDGV 493
                +E  + ++ ++ +E+  E++ + +   E++S++E  G+ ++E+ + T    S+  
Sbjct: 455 ----LSEEEEGDSKSDAEESDAESETEGEGAEEEQSSTEKEGESNEEEQSSTEKEESNEE 510

Query: 494 ETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTY 553
           E   +  +  NE    +T+K+ E++E+     E SST+      E+ ++    ++ +   
Sbjct: 511 EQSSTEKEESNEEEQSSTEKEGESNEE-----EQSSTEKEESNEEEQSSTEKEEESNEEE 565

Query: 554 KSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDES 613
           +SS+   +SN      +E     ++E+    S +E ++D   E   T  +   E+++ E 
Sbjct: 566 QSSTEKEESN------EEEEEEEESESNEEESEEEDQKDEEEEE--TGEEDEEEEEESEE 617

Query: 614 SNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDA 673
            N E   +  + ++  +D      E    + +E  +   ++   E+ +E +   E   DA
Sbjct: 618 QNQEEEAE--EEEDGETDVQEEEEEEEETEKEEEDEEEETEKEEEDEEEETDRVEEEEDA 675

Query: 674 NQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHS----D 729
            +N              +  E E S   +  E+DGE  ++E  ES+  +DE   S    +
Sbjct: 676 EEN--------------EEEEEEESNSEEDEESDGEEEEDE--ESDSEEDEEEESESEEE 719

Query: 730 EGSNSNTNDQGSSSDPSITEEVKES 754
           EG  S + ++      S  EE +ES
Sbjct: 720 EGEESESEEEEGEESESEEEEGEES 744



 Score =  143 bits (360), Expect = 2e-32
 Identities = 91/352 (25%), Positives = 181/352 (50%), Gaps = 19/352 (5%)

Query: 40  TNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLD 99
           +  KKAS  E      +   L  ++     E  +  DA   + + E+E E   EEQ + +
Sbjct: 435 SERKKASESEEEGEEEEADSLSEEE-----EGDSKSDAEESDAESETEGEGAEEEQSSTE 489

Query: 100 -------EVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSE 152
                  E  S  E E  ++ E+   + +++N  +++  E + E + +   +   +E++E
Sbjct: 490 KEGESNEEEQSSTEKEESNEEEQSSTEKEESNEEEQSSTEKEGESNEEEQSSTEKEESNE 549

Query: 153 HSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKE 212
             Q   E E E + E   +  + E + E+  EE + +ES E +S  +E+++++ E E  E
Sbjct: 550 EEQSSTEKEEESNEEEQSSTEKEESNEEE--EEEEESESNEEES-EEEDQKDEEEEETGE 606

Query: 213 AAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEV 272
             E  EE+S+++N+E + +E E+ + +V++ E  E + EK +++ EE  +KE E+ + E 
Sbjct: 607 EDEEEEEESEEQNQEEEAEEEEDGETDVQEEEEEEEETEKEEEDEEEETEKEEEDEEEET 666

Query: 273 EDKEAGEVKEEKSQQENEETKDKENEEIKNEVE-DKEAGEVKEEKSRQENEETKDKENEE 331
           +  E  E  EE  ++E EE+  +E+EE   E E D+E+   ++E+   E+EE + +E+E 
Sbjct: 667 DRVEEEEDAEENEEEEEEESNSEEDEESDGEEEEDEESDSEEDEEEESESEEEEGEESES 726

Query: 332 INQNGTDVKDHVEENHEQDSKEE---KEESNGTEAEKEEQGKIQEEASSEKQ 380
             + G + +   EE  E D +EE   K++    +  ++ +  ++ +A+  K+
Sbjct: 727 EEEEGEESESEEEEGEESDREEEEEIKKKKRPVKLGRQHRSGVKGQAAEPKE 778



 Score =  112 bits (280), Expect = 4e-23
 Identities = 80/293 (27%), Positives = 149/293 (50%), Gaps = 21/293 (7%)

Query: 38  KHTNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQIN 97
           + +NE++ S  E  ++  +      K+     EE +  +   +E +EE +  ++ EE+ N
Sbjct: 505 EESNEEEQSSTEKEESNEEEQSSTEKEGESNEEEQSSTEK--EESNEEEQSSTEKEEESN 562

Query: 98  LDEVNSVDENEP--EHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQ 155
            +E +S ++ E   E + EEE     ++N  +  E + K EE  +  + +  +E  E S+
Sbjct: 563 EEEQSSTEKEESNEEEEEEEE----SESNEEESEEEDQKDEEEEETGEED--EEEEEESE 616

Query: 156 DLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAE 215
           +  + E     E+  TD++ E+  E   EE++  E  E +   KE E+ + E +  E  E
Sbjct: 617 EQNQEEEAEEEEDGETDVQEEEEEE---EETEKEEEDEEEETEKEEEDEEEETDRVEEEE 673

Query: 216 VHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDK 275
             EE  ++E EE+  +E+EE   E E+ E  E   E+ ++E  E++++E EE ++E E+ 
Sbjct: 674 DAEENEEEEEEESNSEEDEESDGEEEEDE--ESDSEEDEEEESESEEEEGEESESEEEEG 731

Query: 276 EAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKE 328
           E  E +EE    E EE+  +E EEIK +    + G  ++ +S  + +  + KE
Sbjct: 732 EESESEEE----EGEESDREEEEEIKKKKRPVKLG--RQHRSGVKGQAAEPKE 778


>UniRef100_Q8EVB9 DNA topoisomerase IV subunit A [Mycoplasma penetrans]
          Length = 1481

 Score =  189 bits (481), Expect = 2e-46
 Identities = 160/690 (23%), Positives = 329/690 (47%), Gaps = 66/690 (9%)

Query: 126  VDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEE 185
            ++ ++  N    + +   ++ + ENS+ ++D   H  E   E    + + ++ +EK   +
Sbjct: 814  IETSQTNNFLTLNSEKSSSSELKENSDDNEDDEHHFVEDDVEIIPIE-KLKKQLEKQQPK 872

Query: 186  SDNTESKENDSLVKENEENKHEAENKEAAEVHE--EKSQQENEETKDKENEEIKNE---- 239
             +  ES  N ++++E E+NK+ +++    E+    EK +++ E+ + +E EE++N     
Sbjct: 873  ENEFESSTNFNILEEMEKNKNSSKSNTKKEIEPSIEKVEEKTEDNQIQE-EELENNSDEI 931

Query: 240  VEDTEAGEVKVEKSQQENEETK-DKENEEIK-NEVEDKEAGEVKEEKSQQENEETKDKEN 297
            +E+++  E+ +E +++ENE+   D+ +++IK  E ED E    ++ +S  EN+E +D   
Sbjct: 932  IEESDNEELALEDAEEENEDNNSDESDDDIKITESEDSEDDNSEDYESDDENDELEDSTE 991

Query: 298  EEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGT-DVKDHVEENHEQDSKEEKE 356
            E      ED+E  +  EE S  E E T+ +++E+ NQ+ + D +D  EE  + +S +E +
Sbjct: 992  E-----TEDEEYYDDSEE-SEDETEITESEDSEDDNQDESYDEEDDSEETEDYESDDEND 1045

Query: 357  ESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENY-AGDNASSAVDHK------- 408
            E    ++E+ E  +  +E + ++  +D E N+E   EE Y   D  S + D +       
Sbjct: 1046 EEYSDDSEETEDEEYSDEENDDES-EDSEENSEDDSEELYDESDEDSESYDEETEGYESD 1104

Query: 409  ----------SQDIFNESYNKTEQVD--KNEKNESEMESQKSGTETNEVTDSNATTNIQE 456
                      S++I +ESY++ +  +  ++E  +SE  S+    E  + +D   T + + 
Sbjct: 1105 DENDEEYSDDSEEIVDESYDEEDDPEETEDESEDSEENSEDDSEELYDESDDEETEDYES 1164

Query: 457  NGGENQAQTDNGSEKRS---TSESGGQQHQEQNNP--------TSDGVETVDSSSQNGNE 505
            +   N+  +D   E        E   ++ +++  P         SD  E  D+ S    +
Sbjct: 1165 DDENNEEYSDESEEIEDEFYDEEDDPEETEDEEYPDDESDDLDISDEDENEDNDSDESED 1224

Query: 506  TTSHT--TDKQNETSEDANS-KVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDS 562
             T  T   D +++ SED  S ++EDS+ +T   +  D + + + DD +  Y  S  +S+S
Sbjct: 1225 ETEITEIKDSEDDNSEDYESDELEDSTEETEDEEYSDDSEENSEDDSEELYDESDEDSES 1284

Query: 563  NANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDS 622
            +     Y+ET +  ++++ N     +  ++   E+     +  SE+ +DE  + E N D 
Sbjct: 1285 D-----YEETED-YESDDENDEEYSDDSEEIEDESY--DEEDGSEETEDEEYSDEENDDE 1336

Query: 623  VQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNE 682
             ++   NS+  ++      +D++E     S D + EE  + S   E+ S   ++ S    
Sbjct: 1337 SEDSEENSE-DDSEELYDESDDEETEDYESDDENDEEYSDDSEEIEDESYDEEDDSEEET 1395

Query: 683  NDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSS 742
            +D    S + +E+++      S+ D E+   E+ + E + D+  + +E  N    D+ S 
Sbjct: 1396 DDESEDSEENSEDDSEELYDESDEDSESDDEETEDEEYSDDD--YEEELENEFEEDESSD 1453

Query: 743  SDPSITEEVKESHIDLGTLPESNAESNHRD 772
             D    EE + S  DL  + E + +    +
Sbjct: 1454 ED---EEESEFSFDDLNDMEEDDLDDEDNE 1480



 Score =  188 bits (477), Expect = 6e-46
 Identities = 155/645 (24%), Positives = 301/645 (46%), Gaps = 59/645 (9%)

Query: 80   KEQDEESEHESKT--------EEQINLDEVNSVDENEP-----EHKPEEEHIKLDDANGV 126
            K+Q +E+E ES T        E+  N  + N+  E EP     E K E+  I+ ++    
Sbjct: 868  KQQPKENEFESSTNFNILEEMEKNKNSSKSNTKKEIEPSIEKVEEKTEDNQIQEEELENN 927

Query: 127  DENEVENKPEEHIKLDDAN--GVDENSEHSQDLVE-HEGEGSSENARTDIESEQHVEKVG 183
             +  +E    E + L+DA     D NS+ S D ++  E E S ++   D ES+   +++ 
Sbjct: 928  SDEIIEESDNEELALEDAEEENEDNNSDESDDDIKITESEDSEDDNSEDYESDDENDEL- 986

Query: 184  EESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDT 243
               D+TE  E++    ++EE++ E E  E+ +  ++   +  +E  D E      E ED 
Sbjct: 987  --EDSTEETEDEEYYDDSEESEDETEITESEDSEDDNQDESYDEEDDSE------ETEDY 1038

Query: 244  EAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNE 303
            E+ +   E+   ++EET+D+E  + +N+ E +++    EE S+ ++EE  D+ +E+ ++ 
Sbjct: 1039 ESDDENDEEYSDDSEETEDEEYSDEENDDESEDS----EENSEDDSEELYDESDEDSESY 1094

Query: 304  VEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEA 363
             E+ E  E     S  EN+E    ++EEI     D +D  EE   +D  E+ EE++  E 
Sbjct: 1095 DEETEGYE-----SDDENDEEYSDDSEEIVDESYDEEDDPEET--EDESEDSEENS--ED 1145

Query: 364  EKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQV 423
            + EE     ++  +E    D E NNE++ +E+   ++     +   ++  +E Y   E  
Sbjct: 1146 DSEELYDESDDEETEDYESDDE-NNEEYSDESEEIEDEFYDEEDDPEETEDEEYPDDESD 1204

Query: 424  DKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQ 483
            D +  +E E E      +++E  D    T I+++  +N    ++   + ST E+  +++ 
Sbjct: 1205 DLDISDEDENED----NDSDESEDETEITEIKDSEDDNSEDYESDELEDSTEETEDEEYS 1260

Query: 484  E--QNNPTSDGVETVDSSSQNG----NETTSHTTDKQN-ETSEDANSKVEDSSTDTTTPK 536
            +  + N   D  E  D S ++      ET  + +D +N E   D + ++ED S D     
Sbjct: 1261 DDSEENSEDDSEELYDESDEDSESDYEETEDYESDDENDEEYSDDSEEIEDESYDEEDGS 1320

Query: 537  TEDSNADAAGDDVDSTYKSSSGNSDSNAN---NGAYKETTNLVQNENPNGNSVQEGKQDA 593
             E  + + + ++ D   + S  NS+ ++    + +  E T   ++++ N     +  ++ 
Sbjct: 1321 EETEDEEYSDEENDDESEDSEENSEDDSEELYDESDDEETEDYESDDENDEEYSDDSEEI 1380

Query: 594  SHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSS 653
              E+     D S E+  DES ++E N++    +  +      + E S +D++E      S
Sbjct: 1381 EDES-YDEEDDSEEETDDESEDSEENSEDDSEELYDE-----SDEDSESDDEETEDEEYS 1434

Query: 654  DVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENS 698
            D   EE  E     + SSD ++  S  + +D  +   D  ++E++
Sbjct: 1435 DDDYEEELENEFEEDESSDEDEEESEFSFDDLNDMEEDDLDDEDN 1479



 Score =  170 bits (430), Expect = 2e-40
 Identities = 139/629 (22%), Positives = 298/629 (47%), Gaps = 49/629 (7%)

Query: 49   ESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEH------ESKTEEQINLDEVN 102
            E  K  N      +K++ P +E+       ++ Q+EE E+      E    E++ L++  
Sbjct: 887  EMEKNKNSSKSNTKKEIEPSIEKVEEKTEDNQIQEEELENNSDEIIEESDNEELALEDAE 946

Query: 103  SVDENEPEHKPE-EEHIKLDDANGVDENEVEN--KPEEHIKLDDANGVDENSEHSQDLVE 159
              +ENE  +  E ++ IK+ ++   +++  E+    +E+ +L+D+    E+ E+  D  E
Sbjct: 947  --EENEDNNSDESDDDIKITESEDSEDDNSEDYESDDENDELEDSTEETEDEEYYDDSEE 1004

Query: 160  HEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEE 219
             E E     +  D E +   E   EE D+ E+++ +S  + +EE   ++E  E  E  +E
Sbjct: 1005 SEDETEITESE-DSEDDNQDESYDEEDDSEETEDYESDDENDEEYSDDSEETEDEEYSDE 1063

Query: 220  KSQQENEETKDK---ENEEIKNEV-EDTEAGEVKVE--KSQQENEETKDKENEEIKNEVE 273
            ++  E+E++++    ++EE+ +E  ED+E+ + + E  +S  EN+E    ++EEI +E  
Sbjct: 1064 ENDDESEDSEENSEDDSEELYDESDEDSESYDEETEGYESDDENDEEYSDDSEEIVDESY 1123

Query: 274  DKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEIN 333
            D+E    + E   +++EE  + ++EE+ +E +D+E           E+ E+ D+ NEE +
Sbjct: 1124 DEEDDPEETEDESEDSEENSEDDSEELYDESDDEET----------EDYESDDENNEEYS 1173

Query: 334  QNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHRE 393
                +++D   +  E+D  EE E+    + E ++     E+ + +    + E   E    
Sbjct: 1174 DESEEIEDEFYD--EEDDPEETEDEEYPDDESDDLDISDEDENEDNDSDESEDETEITEI 1231

Query: 394  ENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTN 453
            ++   DN+    D++S ++  +S  +TE  D+   ++SE  S+    E  + +D ++ ++
Sbjct: 1232 KDSEDDNSE---DYESDEL-EDSTEETE--DEEYSDDSEENSEDDSEELYDESDEDSESD 1285

Query: 454  IQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDK 513
             +E   E+    D   E+ S      ++ ++++    DG E  +    +  E    + D 
Sbjct: 1286 YEET--EDYESDDENDEEYS---DDSEEIEDESYDEEDGSEETEDEEYSDEENDDESEDS 1340

Query: 514  QNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETT 573
            + E SED + ++ D S D    +TED  +D   D+  S       +   +  + + +ET 
Sbjct: 1341 E-ENSEDDSEELYDESDD---EETEDYESDDENDEEYSDDSEEIEDESYDEEDDSEEETD 1396

Query: 574  NLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGS 633
            +  ++   N     E   D S E     S++  E+ +DE  + +   + ++N+    + S
Sbjct: 1397 DESEDSEENSEDDSEELYDESDE----DSESDDEETEDEEYSDDDYEEELENEFEEDESS 1452

Query: 634  NTNSEGSANDNKEASQVNSSDVSSEESKE 662
            + + E S     + + +   D+  E++++
Sbjct: 1453 DEDEEESEFSFDDLNDMEEDDLDDEDNED 1481



 Score =  157 bits (398), Expect = 9e-37
 Identities = 139/599 (23%), Positives = 285/599 (47%), Gaps = 60/599 (10%)

Query: 184  EESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENE-EIKNEVED 242
            E+S ++E KEN     +NE+++H     +   +  EK +++ E+ + KENE E       
Sbjct: 828  EKSSSSELKENSD---DNEDDEHHFVEDDVEIIPIEKLKKQLEKQQPKENEFESSTNFNI 884

Query: 243  TEAGEVKVEKSQQENEETKDKENEEIKNEVEDK-EAGEVKEEKSQQENEET-KDKENEEI 300
             E    ++EK++  ++    KE E    +VE+K E  +++EE+ +  ++E  ++ +NEE+
Sbjct: 885  LE----EMEKNKNSSKSNTKKEIEPSIEKVEEKTEDNQIQEEELENNSDEIIEESDNEEL 940

Query: 301  KNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNG 360
               +ED E  E ++  S + +++ K  E+E       D +D   E++E D + ++ E + 
Sbjct: 941  A--LEDAEE-ENEDNNSDESDDDIKITESE-------DSEDDNSEDYESDDENDELEDST 990

Query: 361  TEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENY-AGDNASSAVDHKSQDIFNESYNK 419
             E E EE     EE+  E ++ + E + + +++E+Y   D++    D++S D  +E Y+ 
Sbjct: 991  EETEDEEYYDDSEESEDETEITESEDSEDDNQDESYDEEDDSEETEDYESDDENDEEYS- 1049

Query: 420  TEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGG 479
                D +E+ E E  S +   + +E ++ N+  + +E   E+   +++  E+    ES  
Sbjct: 1050 ----DDSEETEDEEYSDEENDDESEDSEENSEDDSEELYDESDEDSESYDEETEGYESDD 1105

Query: 480  QQHQEQNNPTSDGVETVDSS--SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKT 537
            +  +E ++   D  E VD S   ++  E T   ++   E SED + ++ D S D    +T
Sbjct: 1106 ENDEEYSD---DSEEIVDESYDEEDDPEETEDESEDSEENSEDDSEELYDESDDE---ET 1159

Query: 538  EDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEA 597
            ED             Y+S   N++  ++     E     + ++P     +E   D S + 
Sbjct: 1160 ED-------------YESDDENNEEYSDESEEIEDEFYDEEDDPEETEDEEYPDDESDDL 1206

Query: 598  QLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNS-EGSANDNKEASQVNSSDVS 656
             ++  D + +   DES +    T+   +++ NS+   ++  E S  + ++    + S+ +
Sbjct: 1207 DISDEDENEDNDSDESEDETEITEIKDSEDDNSEDYESDELEDSTEETEDEEYSDDSEEN 1266

Query: 657  SEE-SKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNES 715
            SE+ S+E    S+  S+++   +   E+D+ N    ++++E        E DG       
Sbjct: 1267 SEDDSEELYDESDEDSESDYEETEDYESDDENDEEYSDDSEEIEDESYDEEDG------- 1319

Query: 716  VESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVS 774
              SE+ +DE  +SDE ++  + D   +S+   +EE+ +   D  T    + + N  + S
Sbjct: 1320 --SEETEDEE-YSDEENDDESEDSEENSEDD-SEELYDESDDEETEDYESDDENDEEYS 1374



 Score =  144 bits (364), Expect = 8e-33
 Identities = 114/501 (22%), Positives = 238/501 (46%), Gaps = 44/501 (8%)

Query: 42   EKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEV 101
            E +  Y +S ++ ++      +D     ++ +  +    E+ E+ E +            
Sbjct: 994  EDEEYYDDSEESEDETEITESEDSEDDNQDESYDEEDDSEETEDYESD------------ 1041

Query: 102  NSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHE 161
               DEN+ E+  + E  + D+    +EN+ E++  E    DD+  + + S+   +  + E
Sbjct: 1042 ---DENDEEYSDDSEETE-DEEYSDEENDDESEDSEENSEDDSEELYDESDEDSESYDEE 1097

Query: 162  GEGSSENARTDIE----SEQHVEKVGEESDNTESKENDSLVKENEENKHE-----AENKE 212
             EG   +   D E    SE+ V++  +E D+ E  E++S  +++EEN  +      +  +
Sbjct: 1098 TEGYESDDENDEEYSDDSEEIVDESYDEEDDPEETEDES--EDSEENSEDDSEELYDESD 1155

Query: 213  AAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKE-NEEIKNE 271
              E  + +S  EN E    E+EEI++E  D E    + E  +  ++E+ D + ++E +NE
Sbjct: 1156 DEETEDYESDDENNEEYSDESEEIEDEFYDEEDDPEETEDEEYPDDESDDLDISDEDENE 1215

Query: 272  VEDKEAGEVKEEKSQ---QENEETKDKENEEIKN---EVEDKEAGEVKEEKSRQENEETK 325
              D +  E + E ++    E++ ++D E++E+++   E ED+E  +  EE S  ++EE  
Sbjct: 1216 DNDSDESEDETEITEIKDSEDDNSEDYESDELEDSTEETEDEEYSDDSEENSEDDSEELY 1275

Query: 326  DKENEEINQNGTDVKDHV--EENHEQ--DSKEEKEESNGTEAEKEEQGKIQEEASSEK-- 379
            D+ +E+   +  + +D+   +EN E+  D  EE E+ +  E +  E+ + +E +  E   
Sbjct: 1276 DESDEDSESDYEETEDYESDDENDEEYSDDSEEIEDESYDEEDGSEETEDEEYSDEENDD 1335

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
            + +D E N+E   EE Y   +     D++S D  +E Y+   +  ++E  + E +S++  
Sbjct: 1336 ESEDSEENSEDDSEELYDESDDEETEDYESDDENDEEYSDDSEEIEDESYDEEDDSEEET 1395

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS 499
             + +E ++ N+  + +E   E+   +++  E+    E     ++E+     +     D S
Sbjct: 1396 DDESEDSEENSEDDSEELYDESDEDSESDDEETEDEEYSDDDYEEE----LENEFEEDES 1451

Query: 500  SQNGNETTSHTTDKQNETSED 520
            S    E +  + D  N+  ED
Sbjct: 1452 SDEDEEESEFSFDDLNDMEED 1472



 Score =  137 bits (345), Expect = 1e-30
 Identities = 134/623 (21%), Positives = 265/623 (42%), Gaps = 87/623 (13%)

Query: 171  TDIESEQH-VEKVGEES--DNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEE 227
            T+ +S  + + K+G+ S    T    N S ++ ++ N     N E +   E K   ++ E
Sbjct: 784  TEADSRMNLITKIGKSSILKGTYLTINKSHIETSQTNNFLTLNSEKSSSSELKENSDDNE 843

Query: 228  TKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENE-EIKNEVEDKEAGEVKEEKSQ 286
              D E+  ++++VE      + +EK +++ E+ + KENE E        E  E  +  S+
Sbjct: 844  --DDEHHFVEDDVEI-----IPIEKLKKQLEKQQPKENEFESSTNFNILEEMEKNKNSSK 896

Query: 287  QENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEEN 346
               ++  +   E+++ + ED +  E  EE     +E  ++ +NEE+      ++D  EEN
Sbjct: 897  SNTKKEIEPSIEKVEEKTEDNQIQE--EELENNSDEIIEESDNEELA-----LEDAEEEN 949

Query: 347  HEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVD 406
             + +S E  ++   TE+E  E     E+  S+ +  + E + E+  +E Y  D+  S   
Sbjct: 950  EDNNSDESDDDIKITESEDSEDDN-SEDYESDDENDELEDSTEETEDEEYYDDSEESE-- 1006

Query: 407  HKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTD 466
                             D+ E  ESE     +  E+ +  D +  T   E+  EN  +  
Sbjct: 1007 -----------------DETEITESEDSEDDNQDESYDEEDDSEETEDYESDDENDEEYS 1049

Query: 467  NGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSE------- 519
            + SE+    E   +++ +++          + S +N  + +    D+ +E SE       
Sbjct: 1050 DDSEETEDEEYSDEENDDES----------EDSEENSEDDSEELYDESDEDSESYDEETE 1099

Query: 520  --------------DANSKVEDSSTDTTTP-KTEDSNADA---AGDDVDSTYKSSSGN-- 559
                          D+   V++S  +   P +TED + D+   + DD +  Y  S     
Sbjct: 1100 GYESDDENDEEYSDDSEEIVDESYDEEDDPEETEDESEDSEENSEDDSEELYDESDDEET 1159

Query: 560  ---SDSNANNGAYKETTNLVQNE------NPNGNSVQEGKQDASHEAQLTASDTSSEQKK 610
                  + NN  Y + +  +++E      +P     +E   D S +  ++  D + +   
Sbjct: 1160 EDYESDDENNEEYSDESEEIEDEFYDEEDDPEETEDEEYPDDESDDLDISDEDENEDNDS 1219

Query: 611  DESSNAETNTDSVQNDNVNS-DGSNTNSEGSANDNKEASQVNSSDVSSE-ESKEGSSNSE 668
            DES +    T+   +++ NS D  +   E S  + ++    + S+ +SE +S+E    S+
Sbjct: 1220 DESEDETEITEIKDSEDDNSEDYESDELEDSTEETEDEEYSDDSEENSEDDSEELYDESD 1279

Query: 669  NSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDG-EAAQNESVESEKAKDESAH 727
              S+++   +   E+D+ N    ++++E        E DG E  ++E    E+  DES  
Sbjct: 1280 EDSESDYEETEDYESDDENDEEYSDDSEEIEDESYDEEDGSEETEDEEYSDEENDDESED 1339

Query: 728  SDEGSNSNTNDQGSSSDPSITEE 750
            S+E S  ++ +    SD   TE+
Sbjct: 1340 SEENSEDDSEELYDESDDEETED 1362



 Score =  115 bits (289), Expect = 4e-24
 Identities = 109/506 (21%), Positives = 218/506 (42%), Gaps = 50/506 (9%)

Query: 282  EEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKD 341
            E+ S  E +E  D   ++  + VED +   +  EK +++ E+ + KENE  +    ++ +
Sbjct: 828  EKSSSSELKENSDDNEDDEHHFVED-DVEIIPIEKLKKQLEKQQPKENEFESSTNFNILE 886

Query: 342  HVEENH---EQDSKEEKEESNGTEAEKEEQGKIQEEA---SSEKQVQDGEGNNEQHREEN 395
             +E+N    + ++K+E E S     EK E  +IQEE    +S++ ++  E +NE+   E+
Sbjct: 887  EMEKNKNSSKSNTKKEIEPSIEKVEEKTEDNQIQEEELENNSDEIIE--ESDNEELALED 944

Query: 396  YAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQ 455
               +N  +  D    DI       TE  D  + N  + ES     E  + T+        
Sbjct: 945  AEEENEDNNSDESDDDI-----KITESEDSEDDNSEDYESDDENDELEDSTEETEDEEYY 999

Query: 456  ENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQN 515
            ++  E++ +T+    + S  ++  + + E++    D  ET D  S + N+       ++ 
Sbjct: 1000 DDSEESEDETEITESEDSEDDNQDESYDEED----DSEETEDYESDDENDEEYSDDSEET 1055

Query: 516  ETSEDANSKVEDSSTDTTTPKTEDSNA--DAAGDDVDSTYKSSSGNSDSNANNGAYKETT 573
            E  E ++ + +D S D+     +DS    D + +D +S  + + G    + N+  Y + +
Sbjct: 1056 EDEEYSDEENDDESEDSEENSEDDSEELYDESDEDSESYDEETEGYESDDENDEEYSDDS 1115

Query: 574  NLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGS 633
              + +E+ +     E  +D S +++  + D  SE+  DES + ET       ++  SD  
Sbjct: 1116 EEIVDESYDEEDDPEETEDESEDSEENSED-DSEELYDESDDEET-------EDYESDDE 1167

Query: 634  NTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDAN 693
            N                  ++  S+ES+E      +  D  +   +    D+ +   D +
Sbjct: 1168 N------------------NEEYSDESEEIEDEFYDEEDDPEETEDEEYPDDESDDLDIS 1209

Query: 694  ENENSVQRKTSENDGEAAQNESVESEKAKDESAHSD--EGSNSNTNDQGSSSDPSITEEV 751
            + + +    + E++ E    E  +SE    E   SD  E S   T D+  S D    E  
Sbjct: 1210 DEDENEDNDSDESEDETEITEIKDSEDDNSEDYESDELEDSTEETEDEEYSDDSE--ENS 1267

Query: 752  KESHIDLGTLPESNAESNHRDVSSAE 777
            ++   +L    + ++ES++ +    E
Sbjct: 1268 EDDSEELYDESDEDSESDYEETEDYE 1293



 Score = 93.2 bits (230), Expect = 3e-17
 Identities = 80/423 (18%), Positives = 173/423 (39%), Gaps = 38/423 (8%)

Query: 371  IQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVD------HKSQDIFNE-----SYNK 419
            +  E SS  ++++   +NE         D     ++       K Q   NE     ++N 
Sbjct: 825  LNSEKSSSSELKENSDDNEDDEHHFVEDDVEIIPIEKLKKQLEKQQPKENEFESSTNFNI 884

Query: 420  TEQVDKNE---KNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSE 476
             E+++KN+   K+ ++ E + S  +  E T+ N     +     ++   ++ +E+ +  +
Sbjct: 885  LEEMEKNKNSSKSNTKKEIEPSIEKVEEKTEDNQIQEEELENNSDEIIEESDNEELALED 944

Query: 477  SGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPK 536
            +  +     ++ + D ++  +S     + +  + +D +N+  ED+  + ED      + +
Sbjct: 945  AEEENEDNNSDESDDDIKITESEDSEDDNSEDYESDDENDELEDSTEETEDEEYYDDSEE 1004

Query: 537  TEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHE 596
            +ED       +D      S   N D + +     E T   ++++ N     +  ++   E
Sbjct: 1005 SEDETEITESED------SEDDNQDESYDEEDDSEETEDYESDDENDEEYSDDSEETEDE 1058

Query: 597  AQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVS 656
                  + S E+  DES ++E N++    +  +    ++ S     +  E+   N  + S
Sbjct: 1059 ------EYSDEENDDESEDSEENSEDDSEELYDESDEDSESYDEETEGYESDDENDEEYS 1112

Query: 657  --SEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNE 714
              SEE  + S + E+  +  ++ S  +E ++ + S +  +  +  + +  E+D E  +  
Sbjct: 1113 DDSEEIVDESYDEEDDPEETEDESEDSEENSEDDSEELYDESDDEETEDYESDDENNEEY 1172

Query: 715  SVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVS 774
            S ESE+ +DE  + +E     T D+    D S          DL    E   E N  D S
Sbjct: 1173 SDESEEIEDE-FYDEEDDPEETEDEEYPDDES---------DDLDISDEDENEDNDSDES 1222

Query: 775  SAE 777
              E
Sbjct: 1223 EDE 1225


>UniRef100_UPI0000180262 UPI0000180262 UniRef100 entry
          Length = 952

 Score =  186 bits (473), Expect = 2e-45
 Identities = 169/782 (21%), Positives = 339/782 (42%), Gaps = 74/782 (9%)

Query: 48  GESAKTGNDVVRLGRKDLNPLVEETTVVDARHK---EQDEESEHESKTEEQINLD----- 99
           G SAK   DV   G   ++   E +T    R +    ++ E   ESK  EQ + D     
Sbjct: 109 GNSAKEREDVETYGHDGIHA-GENSTANGIRGQLGIAENAEEAKESKVHEQPHQDTKTGL 167

Query: 100 --------EVNSVDENEPE---HKPEEEHIKLDDANGVDENEV---------ENKPEEHI 139
                   +   V ENEP+    K    H      +GV   E          EN+  E  
Sbjct: 168 ASDTSQNGDATLVQENEPQVAGSKNSTNHEVGTHGSGVAAQETTPQREGEGSENQGAEVT 227

Query: 140 -KLDDANGVD--ENSEHSQDLVEHEGEGSSENARTDIES--EQHVEKVGEESD----NTE 190
             + +  G+D  E S     + E E  GS +    D     E H    G E      N +
Sbjct: 228 PSIGEGAGLDNTEGSPSGNGIEEDEDTGSGDGVGADAGDGRESHDGTEGHEGQSSGGNND 287

Query: 191 SKENDSLVKENEENKHEAENKEAAEVHEEKSQQEN--EETKDKENEEIKNEVEDTEAGEV 248
           ++   S+  E++++K +  +          S +E   EE    +  +    +  TE G +
Sbjct: 288 NRGQGSVSTEDDDSKEQEGSPNGRGGDNTSSSEETGIEEGDGTQTTQDNQNLSPTEGGII 347

Query: 249 KVEKSQQENEETKDKENEEIKNEVED--KEAGEVKEEKSQQENEETKDKENEEIKNEVED 306
               SQ E   +   +N+ ++ E      ++   KE      ++++      E+      
Sbjct: 348 ----SQAEACPSGQSQNQGLETEGSSTGNKSSITKESGKLSGSKDSNGHHGMELDKRNSP 403

Query: 307 KEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKE 366
           K+      EKS   N     +     N +G D  D  +E+ + D     +ESNG++   +
Sbjct: 404 KQGAA---EKSDTHNNMGHSRIGSSSNSDGHDSYDFDDESMQGDDPNSSDESNGSDGSDD 460

Query: 367 -------EQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQ-DIFNESYN 418
                  E G   + + +  +  D  G+++ +  E+ + D+ S   D  S  D  +ES +
Sbjct: 461 ANSESANENGNHGDASYTSDESSDNGGDSDSYAGEDDSSDDTSDTDDSDSNGDDDSESED 520

Query: 419 KTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESG 478
           K E  + N  N+S+ ES+   +++    DS+++ +   +   + + + + SE   +S+S 
Sbjct: 521 KDESDNSNHDNDSDSESKSDSSDS----DSDSSDSSDSSDSSDSSDSSDSSESSDSSDSS 576

Query: 479 GQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTE 538
                  ++ +SD  ++ DSS  + N+++  +    +  S D++   + S +  ++  +E
Sbjct: 577 DSSDSSDSSDSSDSSDSSDSSDSDSNDSSDSSDSSDSSDSSDSSESSDSSDSSDSSDSSE 636

Query: 539 DSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQ 598
            S +  + D  DS+  S S +S  ++ +    ++++       + +S      D+S  + 
Sbjct: 637 SSESSESSDSSDSSDSSDSSDSSESSESSDSSDSSD-------SSDSDSSDSSDSSDSSD 689

Query: 599 LTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSE 658
             +SD+S      +SS++  ++DS  +D+ +SD S+++    ++D+ ++S  + S  S  
Sbjct: 690 --SSDSSDSSDSSDSSDSSDSSDSDSSDSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSDS 747

Query: 659 ESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVES 718
                SS+S +SSD++ +  +S+ +D+ ++S  ++ +++S    +S++   +  ++S +S
Sbjct: 748 SDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDS 807

Query: 719 EKAKDESAHSD--EGSNSNTNDQGSSSDPSITEEVKES--HIDLGTLPESNAESNHRDVS 774
             + D S  SD  + S+SN++D   SSD S + +  +S    D     +S+  SN  D S
Sbjct: 808 SDSSDSSDSSDSSDSSDSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSS 867

Query: 775 SA 776
            +
Sbjct: 868 DS 869



 Score =  171 bits (433), Expect = 8e-41
 Identities = 131/674 (19%), Positives = 312/674 (45%), Gaps = 47/674 (6%)

Query: 121 DDANGVDENEVENKPEEHIKLDDANGVDEN-----SEHSQDLVEHEGE--GSSENARTDI 173
           DD +   E     +  ++    +  G++E      ++ +Q+L   EG     +E   +  
Sbjct: 298 DDDSKEQEGSPNGRGGDNTSSSEETGIEEGDGTQTTQDNQNLSPTEGGIISQAEACPSGQ 357

Query: 174 ESEQHVEKVGEESDNTES--KENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDK 231
              Q +E  G  + N  S  KE+  L    + N H            E  ++ + +    
Sbjct: 358 SQNQGLETEGSSTGNKSSITKESGKLSGSKDSNGHHGM---------ELDKRNSPKQGAA 408

Query: 232 ENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEE 291
           E  +  N +  +  G      S  +  ++ D ++E ++        G+      +    +
Sbjct: 409 EKSDTHNNMGHSRIGS----SSNSDGHDSYDFDDESMQ--------GDDPNSSDESNGSD 456

Query: 292 TKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDS 351
             D  N E  NE  +        ++S     ++     E+ + + T   D  + N + DS
Sbjct: 457 GSDDANSESANENGNHGDASYTSDESSDNGGDSDSYAGEDDSSDDTSDTDDSDSNGDDDS 516

Query: 352 K-EEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQ 410
           + E+K+ES+ +  + +   + + ++S      D + ++    + + + D++ S+   +S 
Sbjct: 517 ESEDKDESDNSNHDNDSDSESKSDSS------DSDSDSSDSSDSSDSSDSSDSSDSSESS 570

Query: 411 DIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQ-TDNGS 469
           D  ++S + ++  D ++ ++S   S  S +++N+ +DS+ +++  ++   +++  + + S
Sbjct: 571 DS-SDSSDSSDSSDSSDSSDSSDSSDSSDSDSNDSSDSSDSSDSSDSSDSSESSDSSDSS 629

Query: 470 EKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDAN--SKVED 527
           +   +SES        ++ +SD  ++ DSS  + +  +S ++D  +  S D++  S   D
Sbjct: 630 DSSDSSESSESSESSDSSDSSDSSDSSDSSESSESSDSSDSSDSSDSDSSDSSDSSDSSD 689

Query: 528 SSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQ 587
           SS  + +  + DS+  +   D DS+   SS +SDS+ ++ +   + +   +++ N +S  
Sbjct: 690 SSDSSDSSDSSDSSDSSDSSDSDSSDSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSDSSD 749

Query: 588 EGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGS----AND 643
                 S ++  ++  + S    D S +++++  S  +D+ +S  S+ +S+ S    ++D
Sbjct: 750 SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSD 809

Query: 644 NKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKT 703
           + ++S  + S  SS+ +   SS+S +SSD++ +  +S+ +D+ ++S D++++ NS     
Sbjct: 810 SSDSSDSSDSSDSSDSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSS-DSSDSSNSSDSSD 868

Query: 704 SENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPE 763
           S +DG+++  +S +S+ +  +S++S +  +S+++D  SS       + K+S  D      
Sbjct: 869 S-SDGDSSDGDSSDSDSSDSDSSNSSDSDSSDSSDSSSSDSSDSDSDSKDSTSDSSDDDS 927

Query: 764 SNAESNHRDVSSAE 777
            +   N    S +E
Sbjct: 928 KSGNGNSDSDSDSE 941



 Score =  163 bits (412), Expect = 2e-38
 Identities = 117/655 (17%), Positives = 303/655 (45%), Gaps = 32/655 (4%)

Query: 70  EETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDEN 129
           EET + +    +  +++++ S TE  I      S  E  P  + + + ++ + ++  +++
Sbjct: 320 EETGIEEGDGTQTTQDNQNLSPTEGGII-----SQAEACPSGQSQNQGLETEGSSTGNKS 374

Query: 130 EVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEES--D 187
            +    +E  KL  +   D N  H  +L +          ++D  +     ++G  S  D
Sbjct: 375 SIT---KESGKLSGSK--DSNGHHGMELDKRNSPKQGAAEKSDTHNNMGHSRIGSSSNSD 429

Query: 188 NTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGE 247
             +S + D    + ++     E+  +    +  S+  NE     +     +E  D     
Sbjct: 430 GHDSYDFDDESMQGDDPNSSDESNGSDGSDDANSESANENGNHGDASYTSDESSDNGGDS 489

Query: 248 VKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDK 307
                    +++T D ++ +  N  +D E+    E+K + +N    +  + E K++  D 
Sbjct: 490 DSYAGEDDSSDDTSDTDDSD-SNGDDDSES----EDKDESDNSNHDNDSDSESKSDSSDS 544

Query: 308 EAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEE 367
           ++ +  +     ++ ++ D  +   + + +D  D  + +   DS +  + S+ ++++  +
Sbjct: 545 DS-DSSDSSDSSDSSDSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSDSND 603

Query: 368 QGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNE 427
                + + S       E ++     ++   D++ S+   +S D  ++S + ++  D +E
Sbjct: 604 SSDSSDSSDSSDSSDSSESSDSSDSSDS--SDSSESSESSESSDS-SDSSDSSDSSDSSE 660

Query: 428 KNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNN 487
            +ES   S  S +  ++ +DS+ +++      ++   +D+     S+  S        ++
Sbjct: 661 SSESSDSSDSSDSSDSDSSDSSDSSD----SSDSSDSSDSSDSSDSSDSSDSSDSDSSDS 716

Query: 488 PTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGD 547
            +SD  ++ DSS  + +  +S ++D  N  S D++   + S +  ++  ++ S++  + D
Sbjct: 717 DSSDSSDSSDSSDSSDSSDSSDSSDSSNSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSD 776

Query: 548 DVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSE 607
             DS+  S S +S  ++++    ++++   + + + +S      D+S      +SD+S  
Sbjct: 777 SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNSSDSSDSSDS 836

Query: 608 QKKDESSNAETNTDSVQN----DNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEG 663
               +SS++  ++DS  +    D+ NS  S+ +S+G ++D  ++S  +SSD  S+ S   
Sbjct: 837 SDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDGDSSDG-DSSDSDSSD--SDSSNSS 893

Query: 664 SSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVES 718
            S+S +SSD++ + S+ +++D+ +++ D++++++      S++D ++  ++S  S
Sbjct: 894 DSDSSDSSDSSSSDSSDSDSDSKDSTSDSSDDDSKSGNGNSDSDSDSEGSDSNHS 948



 Score =  161 bits (408), Expect = 6e-38
 Identities = 144/682 (21%), Positives = 302/682 (44%), Gaps = 81/682 (11%)

Query: 171 TDIESEQHVEKVGEESDNTESKENDSLVKENEEN---KHEAENKEAAEVHEEKS------ 221
           T  ++E H+ K   +SD+ +S +   L ++   N   + +    E+  V  + S      
Sbjct: 45  TAAQNELHINKATNDSDSDDSPKGSELGRQVHSNGGYERDRNGSESIAVGGKSSPTQPIL 104

Query: 222 -QQENEETKDKENEEI---------KNEVEDTEAGEVKVEKSQQENEETK--DKENEEIK 269
              +    K++E+ E          +N   +   G++ + ++ +E +E+K  ++ +++ K
Sbjct: 105 ANAQGNSAKEREDVETYGHDGIHAGENSTANGIRGQLGIAENAEEAKESKVHEQPHQDTK 164

Query: 270 NEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKEN 329
             +   +  +  +    QENE           +EV    +G   +E + Q   E  + + 
Sbjct: 165 TGLA-SDTSQNGDATLVQENEPQVAGSKNSTNHEVGTHGSGVAAQETTPQREGEGSENQG 223

Query: 330 EEI-----------NQNGTDVKDHVEENHE--------QDSKEEKEESNGTEAEKEEQ-- 368
            E+           N  G+   + +EE+ +         D+ + +E  +GTE  + +   
Sbjct: 224 AEVTPSIGEGAGLDNTEGSPSGNGIEEDEDTGSGDGVGADAGDGRESHDGTEGHEGQSSG 283

Query: 369 GKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVD---------HKSQDIFNESYNK 419
           G            +D +   ++       GDN SS+ +           +QD  N S  +
Sbjct: 284 GNNDNRGQGSVSTEDDDSKEQEGSPNGRGGDNTSSSEETGIEEGDGTQTTQDNQNLSPTE 343

Query: 420 TEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGS-----EKRST 474
              + + E   S  +SQ  G ET   +  N ++  +E+G  + ++  NG      +KR++
Sbjct: 344 GGIISQAEACPSG-QSQNQGLETEGSSTGNKSSITKESGKLSGSKDSNGHHGMELDKRNS 402

Query: 475 SESGGQQHQEQNN----------PTSDGVET--VDSSSQNGNETTSHTTDKQNETSEDAN 522
            + G  +  + +N            SDG ++   D  S  G++  S      ++ S+DAN
Sbjct: 403 PKQGAAEKSDTHNNMGHSRIGSSSNSDGHDSYDFDDESMQGDDPNSSDESNGSDGSDDAN 462

Query: 523 SKVEDSS-----TDTTTPKTEDSNADA---AGDDVDSTYKSSSGNSDSNANNGAYKETTN 574
           S+  + +        T+ ++ D+  D+   AG+D  S   S + +SDSN ++ +  E  +
Sbjct: 463 SESANENGNHGDASYTSDESSDNGGDSDSYAGEDDSSDDTSDTDDSDSNGDDDSESEDKD 522

Query: 575 LVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSN 634
              N N + +S  E K D+S     ++  + S    D S +++++  S  +D  +SD S+
Sbjct: 523 ESDNSNHDNDSDSESKSDSSDSDSDSSDSSDSSDSSDSSDSSDSSESSDSSD--SSDSSD 580

Query: 635 TNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANE 694
           ++    ++D+ ++S  + SD +       SS+S +SSD++++  +S+ +D+ ++S  +  
Sbjct: 581 SSDSSDSSDSSDSSDSSDSDSNDSSDSSDSSDSSDSSDSSESSDSSDSSDSSDSSESSES 640

Query: 695 NENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKES 754
           +E+S    +S++   +  +ES ES  + D S  SD  S S+++D   SSD S + +  +S
Sbjct: 641 SESSDSSDSSDSSDSSDSSESSESSDSSDSSDSSDSDS-SDSSDSSDSSDSSDSSDSSDS 699

Query: 755 HIDLGTLPESNAESNHRDVSSA 776
                +   S+++S+  D S +
Sbjct: 700 SDSSDSSDSSDSDSSDSDSSDS 721


>UniRef100_Q8I2D8 P. falciparum RESA-like protein with DnaJ domain [Plasmodium
           falciparum]
          Length = 1451

 Score =  186 bits (472), Expect = 2e-45
 Identities = 184/744 (24%), Positives = 330/744 (43%), Gaps = 103/744 (13%)

Query: 70  EETTVVDARHKEQDEESEHESKTE--------EQINLDEVNSVDENEPEHKPEEEHIKLD 121
           +E TVV+ +   +D++   E + E        E++  +E +   E+  E K +E     +
Sbjct: 268 KEDTVVEKKENVEDQKDTEEVREEASEDKGDIEEVGKEEASEDKEDTEEVKEQEVSEDKE 327

Query: 122 DANGVDENEV----ENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQ 177
           DA  V + EV    E+K EE  K           E S+D+ + E EG  E +    + E+
Sbjct: 328 DAEEVGKGEVSEDIEDKEEEGEK-----------EVSEDIEDKEEEGEKEESEDKGDKEE 376

Query: 178 HVEKVGEESDNTESKENDSLVKENE--ENKHEAENKEAAEVHEEKSQQENE----ETKDK 231
             +K     + +E KEN   V+E E  E+K +AE     EV E+   +E E    E++DK
Sbjct: 377 EGKK-----EVSEDKENAEEVREEEASEDKEDAEELGKGEVSEDMEDKEEEGKKEESEDK 431

Query: 232 ENEEI--KNEV-EDTE-AGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQ 287
           EN E   K EV ED E A EV+ E++ ++ E+ ++    E+  ++EDKE     EE  ++
Sbjct: 432 ENAEELGKREVSEDKENAEEVREEEASEDKEDAEELGKGEVSEDIEDKE-----EEGEKE 486

Query: 288 ENEETKDKENEEIKNEVEDKE-AGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEEN 346
           E+E+  DKE E  K E EDKE A EV +E++ ++ E+ ++    E++++  +V++   E 
Sbjct: 487 ESEDKGDKEEEGKKEESEDKENAEEVGKEEASEDKEDAEELGKGEVSED-IEVQEEEGEK 545

Query: 347 HEQDSKEEKEESNGTEA-----EKEEQGKIQEEASSE--KQVQDGEGNNEQHREENYAGD 399
            E + K + EE    E      +KE++GK +E    E  ++V++ E + ++   E    +
Sbjct: 546 EESEDKGDAEELGKGEVSEDKEDKEKEGKKEESEDKEDTEEVKEEEASEDKENAEEVGKE 605

Query: 400 NAS---SAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQE 456
            AS      +   +   +E     ++V+K E +E   ++++ G    EV++      +QE
Sbjct: 606 EASEDKEDAEELGKGEVSEDKEDADEVEKEETSEDVRDNEEVG--EGEVSED---IEVQE 660

Query: 457 NGGENQAQTDNGSE-------------------KRSTSESGGQQHQEQNNPTSDGVE-TV 496
             GE +   D G                     K  TSE  G   +     TS+  E T 
Sbjct: 661 EEGEKEESEDKGDAEELGKGEVSEDKGDAEELGKEETSEVKGDAEELGKEETSEDKEYTE 720

Query: 497 DSSSQNGNETTSHTTD-KQNETSEDAN--SKVEDSSTDTTTPKTEDSNADAAGDDVDSTY 553
           +   +  +E    T + K+ E SED     +VE   T      TE+   D   +D++ + 
Sbjct: 721 EVGKEEASEDKEDTEEVKEEEVSEDKGDIEEVEKEETSEDKGDTEEVREDEVSEDIEDSD 780

Query: 554 KSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDES 613
           +   G    +  +    E     +     G+  + GK++AS++ +  A + S + +  E 
Sbjct: 781 EVGEGEVSEDIED---SEEVGKEEEPYEKGDYEEVGKEEASYD-KGDADEVSEDIEDYEE 836

Query: 614 SNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDA 673
              E      +      D      E ++ D  +A ++   + S +   +G S      + 
Sbjct: 837 LGKE------EEPYEKGDYEEVGKEEASYDKGDAEEIGKEEASDD---KGDSEELGKEEE 887

Query: 674 NQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDE-GS 732
                +  E     AS+D  + E   + + S++ G+   +E V  E+A D+  +S+E G 
Sbjct: 888 PYEKGDYEEVGKEEASYDKGDAEEIGKEEASDDKGD---SEEVGKEEASDDKGYSEEVGK 944

Query: 733 NSNTNDQGSSSDPSITEEVKESHI 756
              + D+G + +    E+  E HI
Sbjct: 945 EEGSYDKGDAEE---VEDEDEEHI 965



 Score =  183 bits (464), Expect = 2e-44
 Identities = 161/693 (23%), Positives = 282/693 (40%), Gaps = 64/693 (9%)

Query: 84  EESEHESKTEEQINLDEVNSVDE----------NEPEHKPEEEHIKLDDANGVDENEVEN 133
           EE E E K  +++ L+E+   DE             + K EE+ IK ++    +E +   
Sbjct: 124 EEEEREMKMIKKMELEELEKRDELMEKRRLRRIERMKKKEEEKRIKEEEERIKEEEKRIK 183

Query: 134 KPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKE 193
           + EE IK           E  + L E E     E     ++ E+      EE +  +  E
Sbjct: 184 EEEERIK-----------EEEKRLKEEEERRLKEEEERRLKEEEERRLKEEEKERLKMLE 232

Query: 194 NDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKS 253
            D L KE EE K    N E   V  E+ + +  + K+    E K  VED +  E   E++
Sbjct: 233 EDKLYKEREEQKKNKLNVEEEVVTFERLKSKKMDEKEDTVVEKKENVEDQKDTEEVREEA 292

Query: 254 QQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAG--- 310
            ++  + ++   EE   + ED E  EVKE++  ++ E+ ++    E+  ++EDKE     
Sbjct: 293 SEDKGDIEEVGKEEASEDKEDTE--EVKEQEVSEDKEDAEEVGKGEVSEDIEDKEEEGEK 350

Query: 311 ------EVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAE 364
                 E KEE+  +E  E K  + EE  +  ++ K++ EE  E+++ E+KE++      
Sbjct: 351 EVSEDIEDKEEEGEKEESEDKGDKEEEGKKEVSEDKENAEEVREEEASEDKEDA------ 404

Query: 365 KEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVD 424
            EE GK   E S + + ++ EG  E+  ++  A +     V        +E     E+V 
Sbjct: 405 -EELGK--GEVSEDMEDKEEEGKKEESEDKENAEELGKREV--------SEDKENAEEVR 453

Query: 425 KNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQE 484
           + E +E + ++++ G    EV++       +E  GE +   D G ++    E   ++ ++
Sbjct: 454 EEEASEDKEDAEELG--KGEVSED---IEDKEEEGEKEESEDKGDKE---EEGKKEESED 505

Query: 485 QNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADA 544
           + N    G E      ++  E       +  E  E+   K E   ++      E    + 
Sbjct: 506 KENAEEVGKEEASEDKEDAEELGKGEVSEDIEVQEEEGEKEE---SEDKGDAEELGKGEV 562

Query: 545 AGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDT 604
           + D  D   +     S+   +    KE       EN      +E  +D     +L   + 
Sbjct: 563 SEDKEDKEKEGKKEESEDKEDTEEVKEEEASEDKENAEEVGKEEASEDKEDAEELGKGEV 622

Query: 605 SSEQK-KDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEG 663
           S +++  DE    ET+ D   N+ V   G    SE      +E  +  S D    E    
Sbjct: 623 SEDKEDADEVEKEETSEDVRDNEEV---GEGEVSEDIEVQEEEGEKEESEDKGDAEELGK 679

Query: 664 SSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKD 723
              SE+  DA + G        G+A     E  +  +  T E   E A  +  ++E+ K+
Sbjct: 680 GEVSEDKGDAEELGKEETSEVKGDAEELGKEETSEDKEYTEEVGKEEASEDKEDTEEVKE 739

Query: 724 ESAHSDEGSNSNTNDQGSSSDPSITEEVKESHI 756
           E    D+G       + +S D   TEEV+E  +
Sbjct: 740 EEVSEDKGDIEEVEKEETSEDKGDTEEVREDEV 772



 Score =  180 bits (457), Expect = 1e-43
 Identities = 181/742 (24%), Positives = 320/742 (42%), Gaps = 90/742 (12%)

Query: 76  DARHKEQDEESEHESKT----EEQINLDEVNSVDENEPEHKPEEE-HIKLDDANGVDENE 130
           + R KE++E  + E K     EE+I  +E    +E E   K EEE  +K ++   + E E
Sbjct: 165 EKRIKEEEERIKEEEKRIKEEEERIKEEEKRLKEEEERRLKEEEERRLKEEEERRLKEEE 224

Query: 131 VEN----------KPEEHIKLDDANGVDE--NSEHSQDLVEHEGEGSSENARTDIESEQH 178
            E           K  E  K +  N  +E    E  +     E E +    + ++E ++ 
Sbjct: 225 KERLKMLEEDKLYKEREEQKKNKLNVEEEVVTFERLKSKKMDEKEDTVVEKKENVEDQKD 284

Query: 179 VEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQE-------NEETKDK 231
            E+V EE+   +    +   +E  E+K + E  +  EV E+K   E       +E+ +DK
Sbjct: 285 TEEVREEASEDKGDIEEVGKEEASEDKEDTEEVKEQEVSEDKEDAEEVGKGEVSEDIEDK 344

Query: 232 ENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKE-AGEVKEEKSQQENE 290
           E E  K   ED E  E + EK  +E+E+  DKE E  K   EDKE A EV+EE++ ++ E
Sbjct: 345 EEEGEKEVSEDIEDKEEEGEK--EESEDKGDKEEEGKKEVSEDKENAEEVREEEASEDKE 402

Query: 291 ETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQD 350
           + ++    E+  ++EDKE    KEE   +EN E   K   E++++    K++ EE  E++
Sbjct: 403 DAEELGKGEVSEDMEDKEEEGKKEESEDKENAEELGK--REVSED----KENAEEVREEE 456

Query: 351 SKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQ 410
           + E+KE     +AE+  +G++ E+      ++D E   E+   E+  GD        +S+
Sbjct: 457 ASEDKE-----DAEELGKGEVSED------IEDKEEEGEKEESED-KGDKEEEGKKEESE 504

Query: 411 DIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNG-- 468
           D  N      E+V K E +E + ++++ G    EV++      +QE  GE +   D G  
Sbjct: 505 DKEN-----AEEVGKEEASEDKEDAEELG--KGEVSED---IEVQEEEGEKEESEDKGDA 554

Query: 469 --------SEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSED 520
                   SE +   E  G++ + ++   ++ V+  ++S            DK+N     
Sbjct: 555 EELGKGEVSEDKEDKEKEGKKEESEDKEDTEEVKEEEASE-----------DKENAEEVG 603

Query: 521 ANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNEN 580
                ED        K E S      D+V+    S     +     G   E   + + E 
Sbjct: 604 KEEASEDKEDAEELGKGEVSEDKEDADEVEKEETSEDVRDNEEVGEGEVSEDIEVQEEEG 663

Query: 581 PNGNSVQEGKQDASHEAQLTASDTSSEQ-KKDESSNAETNTDSVQNDNVNSDGSNTNSEG 639
               S  +G  +   + +++     +E+  K+E+S  + + + +  +  + D   T   G
Sbjct: 664 EKEESEDKGDAEELGKGEVSEDKGDAEELGKEETSEVKGDAEELGKEETSEDKEYTEEVG 723

Query: 640 SANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSV 699
                KE +  +  D  +EE KE    SE+  D  +        D G+ + +  E+E S 
Sbjct: 724 -----KEEASEDKED--TEEVKE-EEVSEDKGDIEEVEKEETSEDKGD-TEEVREDEVSE 774

Query: 700 QRKTSENDGEAAQNESVE-SEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVK---ESH 755
             + S+  GE   +E +E SE+   E    ++G       + +S D    +EV    E +
Sbjct: 775 DIEDSDEVGEGEVSEDIEDSEEVGKEEEPYEKGDYEEVGKEEASYDKGDADEVSEDIEDY 834

Query: 756 IDLGTLPESNAESNHRDVSSAE 777
            +LG   E   + ++ +V   E
Sbjct: 835 EELGKEEEPYEKGDYEEVGKEE 856



 Score =  180 bits (456), Expect = 2e-43
 Identities = 186/753 (24%), Positives = 317/753 (41%), Gaps = 82/753 (10%)

Query: 76  DARHKEQDEESEHESKTEEQI-NLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENK 134
           D  +KE++E+ +++   EE++   + + S   +E E    E+   ++D    D  EV  +
Sbjct: 234 DKLYKEREEQKKNKLNVEEEVVTFERLKSKKMDEKEDTVVEKKENVEDQK--DTEEVREE 291

Query: 135 PEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKEN 194
             E     +  G +E SE  +D  E + +  SE    D E  + V K GE S++ E KE 
Sbjct: 292 ASEDKGDIEEVGKEEASEDKEDTEEVKEQEVSE----DKEDAEEVGK-GEVSEDIEDKEE 346

Query: 195 DSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTE-AGEVKVEKS 253
           +      +E   + E+KE     EE  ++E+E+  DKE E  K   ED E A EV+ E++
Sbjct: 347 EG----EKEVSEDIEDKE-----EEGEKEESEDKGDKEEEGKKEVSEDKENAEEVREEEA 397

Query: 254 QQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEE-------TKDKENEEIKNEVED 306
            ++ E+ ++    E+  ++EDKE    KEE   +EN E       ++DKEN E   EV +
Sbjct: 398 SEDKEDAEELGKGEVSEDMEDKEEEGKKEESEDKENAEELGKREVSEDKENAE---EVRE 454

Query: 307 KEAGEVKEEKSR----QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEE-------K 355
           +EA E KE+       + +E+ +DKE E   +   D  D  EE  +++S+++       K
Sbjct: 455 EEASEDKEDAEELGKGEVSEDIEDKEEEGEKEESEDKGDKEEEGKKEESEDKENAEEVGK 514

Query: 356 EESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNE 415
           EE++  + + EE GK   E S + +VQ+ EG  E+  ++  A +     V    +D   E
Sbjct: 515 EEASEDKEDAEELGK--GEVSEDIEVQEEEGEKEESEDKGDAEELGKGEVSEDKEDKEKE 572

Query: 416 SYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENG---GENQAQTDNGS--- 469
              K E  DK +  E + E      E  E       +  +E+    G+ +   D      
Sbjct: 573 G-KKEESEDKEDTEEVKEEEASEDKENAEEVGKEEASEDKEDAEELGKGEVSEDKEDADE 631

Query: 470 -EKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDK--QNETSEDANSKVE 526
            EK  TSE      +      S+ +E  +   +          ++  + E SED     E
Sbjct: 632 VEKEETSEDVRDNEEVGEGEVSEDIEVQEEEGEKEESEDKGDAEELGKGEVSEDKGDAEE 691

Query: 527 DSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSV 586
               +T+  K +           D  Y    G  +++ +    KE T  V+ E      V
Sbjct: 692 LGKEETSEVKGDAEELGKEETSEDKEYTEEVGKEEASED----KEDTEEVKEE-----EV 742

Query: 587 QEGKQDASH-EAQLTASD--TSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSAND 643
            E K D    E + T+ D   + E ++DE S    ++D V    V+ D  ++   G   +
Sbjct: 743 SEDKGDIEEVEKEETSEDKGDTEEVREDEVSEDIEDSDEVGEGEVSEDIEDSEEVGKEEE 802

Query: 644 NKEASQVN--SSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGN--------ASHDAN 693
             E         + +S +  +    SE+  D  + G      + G+        AS+D  
Sbjct: 803 PYEKGDYEEVGKEEASYDKGDADEVSEDIEDYEELGKEEEPYEKGDYEEVGKEEASYDKG 862

Query: 694 ENENSVQRKTSENDGEAAQ-------NESVESEKAKDESAHSDEGSNSNTNDQGSSSDPS 746
           + E   + + S++ G++ +        E  + E+   E A  D+G       + +S D  
Sbjct: 863 DAEEIGKEEASDDKGDSEELGKEEEPYEKGDYEEVGKEEASYDKGDAEEIGKEEASDDKG 922

Query: 747 ITEEV--KESHIDLGTLPESNAESNHRDVSSAE 777
            +EEV  +E+  D G   E   E    D   AE
Sbjct: 923 DSEEVGKEEASDDKGYSEEVGKEEGSYDKGDAE 955



 Score =  171 bits (432), Expect = 1e-40
 Identities = 174/708 (24%), Positives = 295/708 (41%), Gaps = 91/708 (12%)

Query: 48  GESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDEN 107
           GE ++   D    G K+++  +E     D   + + EESE +   EE+    EV+   EN
Sbjct: 335 GEVSEDIEDKEEEGEKEVSEDIE-----DKEEEGEKEESEDKGDKEEE-GKKEVSEDKEN 388

Query: 108 EPEHKPEEEHIKLDDANGVDENEV----ENKPEEHIKLDDANGVDENSEHSQDLVEHEGE 163
             E + EE     +DA  + + EV    E+K EE  K +      E+ E++++L + E  
Sbjct: 389 AEEVREEEASEDKEDAEELGKGEVSEDMEDKEEEGKKEES-----EDKENAEELGKREVS 443

Query: 164 GSSENARTDIESEQHVEKV-------GEESDNTESKEN--------DSLVKENEENKHEA 208
              ENA    E E   +K        GE S++ E KE         D   KE E  K E+
Sbjct: 444 EDKENAEEVREEEASEDKEDAEELGKGEVSEDIEDKEEEGEKEESEDKGDKEEEGKKEES 503

Query: 209 ENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEI 268
           E+KE A   EE  ++E  E K+   E  K EV +    +++V++ + E EE++D      
Sbjct: 504 EDKENA---EEVGKEEASEDKEDAEELGKGEVSE----DIEVQEEEGEKEESED------ 550

Query: 269 KNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKE-AGEVKEEKSRQENEETKDK 327
           K + E+   GEV E+K        +DKE E  K E EDKE   EVKEE++ ++ E  ++ 
Sbjct: 551 KGDAEELGKGEVSEDK--------EDKEKEGKKEESEDKEDTEEVKEEEASEDKENAEEV 602

Query: 328 ENEEINQNGTDV----KDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQD 383
             EE +++  D     K  V E+ E   + EKEE++    + EE G  + E S + +VQ+
Sbjct: 603 GKEEASEDKEDAEELGKGEVSEDKEDADEVEKEETSEDVRDNEEVG--EGEVSEDIEVQE 660

Query: 384 GEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQV--DKNEKNESEMESQKSGTE 441
            EG  E+  ++  A +     V     D       +T +V  D  E  + E    K  TE
Sbjct: 661 EEGEKEESEDKGDAEELGKGEVSEDKGDAEELGKEETSEVKGDAEELGKEETSEDKEYTE 720

Query: 442 TNEVTDSNATTNIQENGGENQAQTDNGS----EKRSTSESGGQQHQEQNNPTSDGVETVD 497
                +++      E   E +   D G     EK  TSE  G   + + +  S+ +E  D
Sbjct: 721 EVGKEEASEDKEDTEEVKEEEVSEDKGDIEEVEKEETSEDKGDTEEVREDEVSEDIE--D 778

Query: 498 SSSQNGNETTSHTTDKQN-ETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSS 556
           S      E +    D +     E+   K +           +  +AD   +D++      
Sbjct: 779 SDEVGEGEVSEDIEDSEEVGKEEEPYEKGDYEEVGKEEASYDKGDADEVSEDIED--YEE 836

Query: 557 SGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNA 616
            G  +     G Y+E                 GK++AS++ +  A +   E+  D+  ++
Sbjct: 837 LGKEEEPYEKGDYEEV----------------GKEEASYD-KGDAEEIGKEEASDDKGDS 879

Query: 617 ETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSD---- 672
           E      +      D      E ++ D  +A ++   + S ++        E +SD    
Sbjct: 880 E-ELGKEEEPYEKGDYEEVGKEEASYDKGDAEEIGKEEASDDKGDSEEVGKEEASDDKGY 938

Query: 673 ANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEK 720
           + + G      D G+A    +E+E  ++ K    + E   +   E+++
Sbjct: 939 SEEVGKEEGSYDKGDAEEVEDEDEEHIRSKEEVKEPEIGTDIEEENKE 986



 Score =  145 bits (367), Expect = 3e-33
 Identities = 152/665 (22%), Positives = 281/665 (41%), Gaps = 84/665 (12%)

Query: 174 ESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKEN 233
           E E+   K+ ++ +  E ++ D L+++    + E   K+     EEK  +E EE   +E 
Sbjct: 124 EEEEREMKMIKKMELEELEKRDELMEKRRLRRIERMKKK----EEEKRIKEEEERIKEEE 179

Query: 234 EEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETK 293
           + IK E E  +    + EK  +E EE + KE EE    ++++E   +KEE    E E  K
Sbjct: 180 KRIKEEEERIK----EEEKRLKEEEERRLKEEEE--RRLKEEEERRLKEE----EKERLK 229

Query: 294 DKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKE 353
             E +++  E E+++  ++  E+     E  K K+ +E      + K++VE+  ++D++E
Sbjct: 230 MLEEDKLYKEREEQKKNKLNVEEEVVTFERLKSKKMDEKEDTVVEKKENVED--QKDTEE 287

Query: 354 EKEESNGTEAEKEEQGKIQEEASSEK----QVQDGEGNNEQHREENYAGDNASSAVDHKS 409
            +EE++  + + EE GK  EEAS +K    +V++ E + ++   E       S  ++ K 
Sbjct: 288 VREEASEDKGDIEEVGK--EEASEDKEDTEEVKEQEVSEDKEDAEEVGKGEVSEDIEDKE 345

Query: 410 QDIFNE-SYNKTEQVDKNEKNESEMESQKSGTETNEVTD--SNATTNIQENGGENQAQTD 466
           ++   E S +  ++ ++ EK ESE +  K      EV++   NA    +E   E++   +
Sbjct: 346 EEGEKEVSEDIEDKEEEGEKEESEDKGDKEEEGKKEVSEDKENAEEVREEEASEDKEDAE 405

Query: 467 -----NGSEKRSTSESGGQQHQEQNNPTSD--GVETVDSSSQNGNETTSH--TTDKQN-- 515
                  SE     E  G++ + ++   ++  G   V    +N  E      + DK++  
Sbjct: 406 ELGKGEVSEDMEDKEEEGKKEESEDKENAEELGKREVSEDKENAEEVREEEASEDKEDAE 465

Query: 516 -----ETSEDANSKVEDSSTDTTTP--------KTEDSNADAAGDDVDSTYKSSSGNSDS 562
                E SED   K E+   + +          K E+S      ++V     S       
Sbjct: 466 ELGKGEVSEDIEDKEEEGEKEESEDKGDKEEEGKKEESEDKENAEEVGKEEASEDKEDAE 525

Query: 563 NANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLT--ASDTSSEQKKDESSNAETNT 620
               G   E   + + E     S  +G  +   + +++    D   E KK+ES + E +T
Sbjct: 526 ELGKGEVSEDIEVQEEEGEKEESEDKGDAEELGKGEVSEDKEDKEKEGKKEESEDKE-DT 584

Query: 621 DSVQNDNVNSDGSNTNSEG---SANDNKEASQVNSSDVSSE-ESKEGSSNSENSSDANQN 676
           + V+ +  + D  N    G   ++ D ++A ++   +VS + E  +     E S D   N
Sbjct: 585 EEVKEEEASEDKENAEEVGKEEASEDKEDAEELGKGEVSEDKEDADEVEKEETSEDVRDN 644

Query: 677 GSNSNENDNGNASHDANENENSVQRKTSENDGEA--------AQNESVESEKAKDESAH- 727
                E   G  S D    E   +++ SE+ G+A        ++++    E  K+E++  
Sbjct: 645 ----EEVGEGEVSEDIEVQEEEGEKEESEDKGDAEELGKGEVSEDKGDAEELGKEETSEV 700

Query: 728 -------------SDEGSNSNTNDQGSSSDPSITEEVKESHI--DLGTLPESNAESNHRD 772
                         D+        + +S D   TEEVKE  +  D G + E   E    D
Sbjct: 701 KGDAEELGKEETSEDKEYTEEVGKEEASEDKEDTEEVKEEEVSEDKGDIEEVEKEETSED 760

Query: 773 VSSAE 777
               E
Sbjct: 761 KGDTE 765



 Score =  104 bits (259), Expect = 1e-20
 Identities = 116/555 (20%), Positives = 222/555 (39%), Gaps = 65/555 (11%)

Query: 251 EKSQQENEETKDKENEEIKNE---------VEDKEAGEVKEEKSQQENEETKDKENEEIK 301
           E+ + + E  K      +KN          ++D + G +  E+ ++E +  K  E EE++
Sbjct: 83  EQIRTQREPQKSNYKASMKNYLKCVKSAPYIDDAKYGALISEEEEREMKMIKKMELEELE 142

Query: 302 NEVEDKEAGEVKE-EKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNG 360
              E  E   ++  E+ +++ EE + KE EE           ++E  ++  +EE+     
Sbjct: 143 KRDELMEKRRLRRIERMKKKEEEKRIKEEEE----------RIKEEEKRIKEEEERIKEE 192

Query: 361 TEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKT 420
            +  KEE+ +  +E    +  ++ E   ++  +E             + +   N+  N  
Sbjct: 193 EKRLKEEEERRLKEEEERRLKEEEERRLKEEEKERLKMLEEDKLYKEREEQKKNK-LNVE 251

Query: 421 EQVDKNEKNESEMESQKSGT---ETNEVTDSNATTNIQENGGENQAQTDN-GSEKRSTSE 476
           E+V   E+ +S+   +K  T   +   V D   T  ++E   E++   +  G E+ S  +
Sbjct: 252 EEVVTFERLKSKKMDEKEDTVVEKKENVEDQKDTEEVREEASEDKGDIEEVGKEEASEDK 311

Query: 477 SGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPK 536
              ++ +EQ    S+  E  D+      E +    DK+ E  ++ +  +ED   +    +
Sbjct: 312 EDTEEVKEQE--VSEDKE--DAEEVGKGEVSEDIEDKEEEGEKEVSEDIEDKEEEGEKEE 367

Query: 537 TEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASH- 595
           +ED      GD  +   K  S +          KE    V+ E        E K+DA   
Sbjct: 368 SEDK-----GDKEEEGKKEVSED----------KENAEEVREE-----EASEDKEDAEEL 407

Query: 596 ---EAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSN---TNSEGSANDNKEASQ 649
              E      D   E KK+ES + E N + +    V+ D  N      E ++ D ++A +
Sbjct: 408 GKGEVSEDMEDKEEEGKKEESEDKE-NAEELGKREVSEDKENAEEVREEEASEDKEDAEE 466

Query: 650 VN----SSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSE 705
           +     S D+  +E +     SE+  D  + G      D  NA  +  + E S  ++ +E
Sbjct: 467 LGKGEVSEDIEDKEEEGEKEESEDKGDKEEEGKKEESEDKENA-EEVGKEEASEDKEDAE 525

Query: 706 NDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEE---VKESHIDLGTLP 762
             G+   +E +E ++ + E   S++  ++    +G  S+    +E    KE   D     
Sbjct: 526 ELGKGEVSEDIEVQEEEGEKEESEDKGDAEELGKGEVSEDKEDKEKEGKKEESEDKEDTE 585

Query: 763 ESNAESNHRDVSSAE 777
           E   E    D  +AE
Sbjct: 586 EVKEEEASEDKENAE 600


>UniRef100_Q7RH28 Mature-parasite-infected erythrocyte surface antigen [Plasmodium
           yoelii yoelii]
          Length = 1003

 Score =  184 bits (468), Expect = 7e-45
 Identities = 197/817 (24%), Positives = 357/817 (43%), Gaps = 92/817 (11%)

Query: 35  YQIKHTNEKKASYGESAKTGNDVVR---LGRKDLNPLVEETTVVDARHKEQDEESE-HES 90
           + IK ++ K +++ ++ K G  V+    +  K+   L +     +  +   D   E  E 
Sbjct: 129 FLIKSSSPKISNFQKNKKMGTSVISTKPVSTKNNMSLFQRPRRKNIIYSSLDSSEEGKEV 188

Query: 91  KTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDEN 150
             EE+   +EV   +E E E + EE  ++ +      E EVE   EE+ ++++   V+E 
Sbjct: 189 IEEEEEEYEEVEVEEEEEVEDEYEEVEVEEEYEEVEVEEEVEEVEEEYEEVEEEEEVEEE 248

Query: 151 SEHSQDLVEHEGEGSSENARTD---IESEQHVEKVGEESDNT--ESKENDSLVKENEENK 205
            E  ++  E E E   E    D   IE E+  E + EE D+   E +E+D +++E E+++
Sbjct: 249 YEEVEE--EEEVEEEHEEIEEDDEVIEEEEDAEVIEEEEDDEVIEEEEDDEVIEEEEDDE 306

Query: 206 HEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKS--QQENEET-KD 262
              E +E  EV EE+ + +    +++++E I  E E+ E GE +  +S    +NEE  KD
Sbjct: 307 VIEEEEEDDEVIEEEEEDDEVIEEEEDDEIIGEEDEEDEMGEKESTQSVTNNKNEELMKD 366

Query: 263 KENEEIKNEVED-----KEAGEVKEEKSQQENEETKDKEN--EEIKNEVEDKEAGEVKEE 315
           KENE   N V D     K+  EV   K    +E+T D EN  +   +++++K+   +   
Sbjct: 367 KENEIKCNIVMDNKEYIKKESEVIIGKKVDNDEKTVDGENNFKNYIDKIQEKDPNYLILV 426

Query: 316 KSRQEN-----------------EETKDKEN--------EEINQNGTDVKD--HVEENHE 348
            +  EN                   TK+  N        ++IN N  D ++  ++  N+E
Sbjct: 427 NNIMENLLKYDDFYNHIKNSINFYYTKNAINNSYFKLLTDDINFNIIDKQNSGNIVYNNE 486

Query: 349 QDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASS----- 403
            ++  EK+ S+    EK+E  +   E     + Q+ +  N + + E Y  +N        
Sbjct: 487 NNNHFEKKNSDELRIEKDEINERNYEVDVSSKTQNSDVKNHKSKIEEYIIENKQDIKKEI 546

Query: 404 AVDHKSQDIFNESYNKTEQVDKNEKNESEMESQK-SGTETNE---VTDSNATTNIQENGG 459
              H   D  + +   T  +++NE NE++++S+     ETNE   ++  N   N   N G
Sbjct: 547 KQKHVGTDTLDINNETTIMMEENENNENDIKSKDYQMIETNEDAKISQDNNNNN-NNNNG 605

Query: 460 ENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSE 519
            +  +     E  +      Q +  + N     +   D S    +  +S    + NE  E
Sbjct: 606 NSSIENYRYPESENVDCVINQSNSVEYNKQLINISKQDDSISESDTCSSEKEVEDNEYEE 665

Query: 520 DANSKVEDSSTDTTTPK-TEDSNADAAGDDVDSTYKSSSG-----------NSDSNANNG 567
             ++K + +  D    K  ED N +   +++ +  K+ SG               N N  
Sbjct: 666 RDDTKKDGNEIDKIDSKCDEDDNEER--EEIITKEKNESGRKVKRGDEPTSGEKENENLS 723

Query: 568 AYKETTNLVQ---NENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQ 624
           +Y ++ N  +    EN N      G+ ++  E  +    ++SE+ + ES + +    SV+
Sbjct: 724 SYVDSKNKNEPNLEENENKRKSFSGESESESEKSINGEGSTSEESESESESEK----SVK 779

Query: 625 NDNVNSDGSNTNSEGSANDNKEASQVNSSD----VSSEESKEGSSNSENSSDANQNGSNS 680
            +   S+ S + SE S    +  S+ + S+    V  EES    S SE+     + GS S
Sbjct: 780 KEESTSEESESESEKSVKKEESTSEESESESEKSVKKEESTSEESESESEKSVKKGGSTS 839

Query: 681 NENDN--------GNASHDANENENSVQRKTSENDGEAAQNESVESEKAKD-ESAHSDEG 731
            E+D+        G ++   +E+E+    K  E+  E ++ ES ES+K  + +S  S+  
Sbjct: 840 EESDSESEKSAKKGGSASGESESESEKSVKKEESTSEESETESEESKKKGEFKSKESESE 899

Query: 732 SNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAES 768
           S  +   + S+S+ S +E  K       T  ES +ES
Sbjct: 900 SEKSVKKEESTSEESESESEKSVKKGGSTSEESESES 936



 Score =  159 bits (403), Expect = 2e-37
 Identities = 193/839 (23%), Positives = 370/839 (44%), Gaps = 133/839 (15%)

Query: 49  ESAKTGNDVVRLGRKDLNPL-VEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDEN 107
           +S++ G +V+    ++   + VEE   V+  ++E + E E+E    E+    EV  V+E 
Sbjct: 180 DSSEEGKEVIEEEEEEYEEVEVEEEEEVEDEYEEVEVEEEYEEVEVEE----EVEEVEE- 234

Query: 108 EPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSE 167
           E E   EEE ++ +     +E EVE   EEH ++++ + V E  E ++ + E E +   E
Sbjct: 235 EYEEVEEEEEVEEEYEEVEEEEEVE---EEHEEIEEDDEVIEEEEDAEVIEEEEDDEVIE 291

Query: 168 NARTD--IESEQHVEKVGEESDNTE----SKENDSLVKENEENKHEAENKEAAEVHEEKS 221
               D  IE E+  E + EE ++ E     +E+D +++E E+++   E  E  E+ E++S
Sbjct: 292 EEEDDEVIEEEEDDEVIEEEEEDDEVIEEEEEDDEVIEEEEDDEIIGEEDEEDEMGEKES 351

Query: 222 QQ-----ENEET-KDKENEEIKNEVEDTEA-----GEVKVEKSQQENEETKDKENEEIKN 270
            Q     +NEE  KDKENE   N V D +       EV + K    +E+T D EN   KN
Sbjct: 352 TQSVTNNKNEELMKDKENEIKCNIVMDNKEYIKKESEVIIGKKVDNDEKTVDGENN-FKN 410

Query: 271 EVE-----------------------DKEAGEVKEE------KSQQENEETK-------- 293
            ++                       D     +K        K+   N   K        
Sbjct: 411 YIDKIQEKDPNYLILVNNIMENLLKYDDFYNHIKNSINFYYTKNAINNSYFKLLTDDINF 470

Query: 294 ---DKENE-------EIKNEVEDKEAGEVKEEKSR-----QENEETKDKENEEINQNGTD 338
              DK+N        E  N  E K + E++ EK        E + +   +N ++  + + 
Sbjct: 471 NIIDKQNSGNIVYNNENNNHFEKKNSDELRIEKDEINERNYEVDVSSKTQNSDVKNHKSK 530

Query: 339 VKDHVEENHEQDSKEEKEESNGTEA---EKEEQGKIQEEASSEKQVQDGE----GNNE-- 389
           +++++ EN +   KE K++  GT+      E    ++E  ++E  ++  +      NE  
Sbjct: 531 IEEYIIENKQDIKKEIKQKHVGTDTLDINNETTIMMEENENNENDIKSKDYQMIETNEDA 590

Query: 390 ---QHREENYAGDNASSAVDH----KSQDIFNESYNKTEQVDKNEK-----------NES 431
              Q    N   +N +S++++    +S+++ +   N++  V+ N++           +ES
Sbjct: 591 KISQDNNNNNNNNNGNSSIENYRYPESENV-DCVINQSNSVEYNKQLINISKQDDSISES 649

Query: 432 EMESQKSGTETNEVTDSNATTNIQENGGE-----NQAQTDNGSEKR----STSESGGQQH 482
           +  S +   E NE  + + T   +++G E     ++   D+  E+           G++ 
Sbjct: 650 DTCSSEKEVEDNEYEERDDT---KKDGNEIDKIDSKCDEDDNEEREEIITKEKNESGRKV 706

Query: 483 QEQNNPTSDGVETVDSS----SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTE 538
           +  + PTS   E  + S    S+N NE      + + ++    +    + S +     +E
Sbjct: 707 KRGDEPTSGEKENENLSSYVDSKNKNEPNLEENENKRKSFSGESESESEKSINGEGSTSE 766

Query: 539 DSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQ 598
           +S +++  +      +S+S  S+S +     KE +   ++E+ +  SV++ ++  S E++
Sbjct: 767 ESESESESEKSVKKEESTSEESESESEKSVKKEESTSEESESESEKSVKK-EESTSEESE 825

Query: 599 LTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGS-NTNSEGSANDNKEASQVNSSDVSS 657
              S++    KK  S++ E++++S ++       S  + SE   +  KE S    S+  S
Sbjct: 826 ---SESEKSVKKGGSTSEESDSESEKSAKKGGSASGESESESEKSVKKEESTSEESETES 882

Query: 658 EESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVE 717
           EESK+        S++    S   E      S   +E+E SV++  S +  E +++ES +
Sbjct: 883 EESKKKGEFKSKESESESEKSVKKEESTSEESE--SESEKSVKKGGSTS--EESESESEK 938

Query: 718 S-EKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSS 775
           S +K    S  S+  S  +   +GS+S+ S +E  K    +  T  ES +ES+   V +
Sbjct: 939 SVKKGGSTSEESESESEKSVKKEGSTSEESESESEKSVKKEESTSEESESESDDNVVET 997



 Score =  150 bits (378), Expect = 2e-34
 Identities = 186/800 (23%), Positives = 340/800 (42%), Gaps = 142/800 (17%)

Query: 70   EETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDE 128
            EE   V+  ++E +EE E E + EE   ++E   V+E   E + ++E I+ + DA  ++E
Sbjct: 227  EEVEEVEEEYEEVEEEEEVEEEYEE---VEEEEEVEEEHEEIEEDDEVIEEEEDAEVIEE 283

Query: 129  NE-----VENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVG 183
             E      E + +E I+ ++ + V E  E   +++E E E         IE E+  E +G
Sbjct: 284  EEDDEVIEEEEDDEVIEEEEDDEVIEEEEEDDEVIEEEEEDDEV-----IEEEEDDEIIG 338

Query: 184  EESDNTESKENDSLVK----ENEENKHEAEN--------------KEAAEVHEEKSQQEN 225
            EE +  E  E +S       +NEE   + EN              K+ +EV   K    +
Sbjct: 339  EEDEEDEMGEKESTQSVTNNKNEELMKDKENEIKCNIVMDNKEYIKKESEVIIGKKVDND 398

Query: 226  EETKDKENEEIKN---EVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVE---DKEAGE 279
            E+T D EN   KN   ++++ +   + +  +  EN    D     IKN +     K A  
Sbjct: 399  EKTVDGENN-FKNYIDKIQEKDPNYLILVNNIMENLLKYDDFYNHIKNSINFYYTKNAIN 457

Query: 280  VKEEK--SQQENEETKDKENE-------EIKNEVEDKEAGEVKEEKSR-----QENEETK 325
                K  +   N    DK+N        E  N  E K + E++ EK        E + + 
Sbjct: 458  NSYFKLLTDDINFNIIDKQNSGNIVYNNENNNHFEKKNSDELRIEKDEINERNYEVDVSS 517

Query: 326  DKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEA---------------------- 363
              +N ++  + + +++++ EN +   KE K++  GT+                       
Sbjct: 518  KTQNSDVKNHKSKIEEYIIENKQDIKKEIKQKHVGTDTLDINNETTIMMEENENNENDIK 577

Query: 364  -------EKEEQGKIQEEASSEKQVQDGEGNNEQHR----EENYAGDNASSAVDHKSQ-- 410
                   E  E  KI ++ ++     +G  + E +R    E      N S++V++  Q  
Sbjct: 578  SKDYQMIETNEDAKISQDNNNNNNNNNGNSSIENYRYPESENVDCVINQSNSVEYNKQLI 637

Query: 411  ------DIFNESY----------NKTEQVDKNEKNESEME--SQKSGTETNEVTDSNATT 452
                  D  +ES           N+ E+ D  +K+ +E++    K   + NE  +   T 
Sbjct: 638  NISKQDDSISESDTCSSEKEVEDNEYEERDDTKKDGNEIDKIDSKCDEDDNEEREEIITK 697

Query: 453  NIQENGGE-NQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSH-T 510
               E+G +  +       EK + + S     + +N P  +  E    S    +E+ S  +
Sbjct: 698  EKNESGRKVKRGDEPTSGEKENENLSSYVDSKNKNEPNLEENENKRKSFSGESESESEKS 757

Query: 511  TDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYK--SSSGNSDSNANNGA 568
             + +  TSE++ S   +S ++ +  K E ++ ++  +   S  K  S+S  S+S +    
Sbjct: 758  INGEGSTSEESES---ESESEKSVKKEESTSEESESESEKSVKKEESTSEESESESEKSV 814

Query: 569  YKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQ--KKDESSNAETNTD---SV 623
             KE +   ++E+ +  SV++G   +        SD+ SE+  KK  S++ E+ ++   SV
Sbjct: 815  KKEESTSEESESESEKSVKKGGSTSEE------SDSESEKSAKKGGSASGESESESEKSV 868

Query: 624  QNDNVNSDGSNTNSEGSAN----DNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            + +   S+ S T SE S       +KE+   +   V  EES    S SE+     + GS 
Sbjct: 869  KKEESTSEESETESEESKKKGEFKSKESESESEKSVKKEESTSEESESESEKSVKKGGST 928

Query: 680  SNENDNGNASHDANENENSVQR-----KTSENDGE-AAQNESVESEKAKDESAHSDEGSN 733
            S E++        +E+E SV++     + SE++ E + + E   SE+++ ES  S +   
Sbjct: 929  SEESE--------SESEKSVKKGGSTSEESESESEKSVKKEGSTSEESESESEKSVKKEE 980

Query: 734  SNTNDQGSSSDPSITEEVKE 753
            S + +  S SD ++ E   E
Sbjct: 981  STSEESESESDDNVVETQSE 1000



 Score =  143 bits (361), Expect = 2e-32
 Identities = 165/708 (23%), Positives = 320/708 (44%), Gaps = 90/708 (12%)

Query: 70   EETTVVDARHKEQDEESEHES-------KTEEQI----NLDEVNSVDENEPEHKPEEEHI 118
            EE   +     E+DE  E ES       K EE +    N  + N V +N+   K E E I
Sbjct: 331  EEDDEIIGEEDEEDEMGEKESTQSVTNNKNEELMKDKENEIKCNIVMDNKEYIKKESEVI 390

Query: 119  ---KLD-DANGVD-ENEVENKPEEHIKLDD-----ANGVDENSEHSQDLVEHEGEGSSEN 168
               K+D D   VD EN  +N  ++  + D       N + EN     D   H     +  
Sbjct: 391  IGKKVDNDEKTVDGENNFKNYIDKIQEKDPNYLILVNNIMENLLKYDDFYNHIKNSINFY 450

Query: 169  ARTDIESEQHVEKVGEESD-NTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEE 227
               +  +  + + + ++ + N   K+N   +  N EN +  E K + E+  EK +     
Sbjct: 451  YTKNAINNSYFKLLTDDINFNIIDKQNSGNIVYNNENNNHFEKKNSDELRIEKDEI---- 506

Query: 228  TKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQ 287
              ++ N E+ +    T+  +VK  KS+ E    ++K+  +IK E++ K  G    +    
Sbjct: 507  --NERNYEV-DVSSKTQNSDVKNHKSKIEEYIIENKQ--DIKKEIKQKHVGT---DTLDI 558

Query: 288  ENEET-KDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEEN 346
             NE T   +ENE  +N+++ K+   ++   + ++ + ++D  N   N NG    ++    
Sbjct: 559  NNETTIMMEENENNENDIKSKDYQMIE---TNEDAKISQDNNNNNNNNNGNSSIENYRYP 615

Query: 347  HEQDSKEEKEESNGTEAEKE------EQGKIQEE--ASSEKQVQDGEGNNEQHREENYAG 398
              ++      +SN  E  K+      +   I E    SSEK+V+D   N  + R++    
Sbjct: 616  ESENVDCVINQSNSVEYNKQLINISKQDDSISESDTCSSEKEVED---NEYEERDDTKKD 672

Query: 399  DNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQK-----SGTETNEVTDSNATT- 452
             N    +D K  +  NE   + E++   EKNES  + ++     SG + NE   S   + 
Sbjct: 673  GNEIDKIDSKCDEDDNE---EREEIITKEKNESGRKVKRGDEPTSGEKENENLSSYVDSK 729

Query: 453  -----NIQENGGENQA---QTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGN 504
                 N++EN  + ++   ++++ SEK    E    +  E  + +   V+  +S+S+   
Sbjct: 730  NKNEPNLEENENKRKSFSGESESESEKSINGEGSTSEESESESESEKSVKKEESTSEESE 789

Query: 505  ETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYK---SSSGNSD 561
              +  +  K+  TSE++ S+ E S       K E+S ++ +  + + + K   S+S  SD
Sbjct: 790  SESEKSVKKEESTSEESESESEKSV------KKEESTSEESESESEKSVKKGGSTSEESD 843

Query: 562  SNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTD 621
            S +   A K  +   ++E+ +  SV+  K++++ E   T S+ S ++ + +S  +E+ ++
Sbjct: 844  SESEKSAKKGGSASGESESESEKSVK--KEESTSEESETESEESKKKGEFKSKESESESE 901

Query: 622  -SVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQN---- 676
             SV+ +   S+ S + SE S       S+ + S+      K GS++ E+ S++ ++    
Sbjct: 902  KSVKKEESTSEESESESEKSVKKGGSTSEESESESEKSVKKGGSTSEESESESEKSVKKE 961

Query: 677  GSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDE 724
            GS S E+++        E+E SV+++ S ++   ++++    E   +E
Sbjct: 962  GSTSEESES--------ESEKSVKKEESTSEESESESDDNVVETQSEE 1001



 Score =  113 bits (282), Expect = 2e-23
 Identities = 102/450 (22%), Positives = 186/450 (40%), Gaps = 50/450 (11%)

Query: 71   ETTVVDARHKEQDEESEHESK--------TEEQINLDEVNSVDENEPEHKPEEEHIKLDD 122
            ETT++     E++E +E++ K        T E   + + N+ + N        E+ +  +
Sbjct: 561  ETTIM----MEENENNENDIKSKDYQMIETNEDAKISQDNNNNNNNNNGNSSIENYRYPE 616

Query: 123  ANGVD-----ENEVE-NKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESE 176
            +  VD      N VE NK   +I   D    D  SE      E E E +    R D + +
Sbjct: 617  SENVDCVINQSNSVEYNKQLINISKQD----DSISESDTCSSEKEVEDNEYEERDDTKKD 672

Query: 177  -QHVEKVGEESDNTESKENDSLVKE------------NEENKHEAENKEAAEVHEEKSQQ 223
               ++K+  + D  +++E + ++ +            +E    E EN+  +   + K++ 
Sbjct: 673  GNEIDKIDSKCDEDDNEEREEIITKEKNESGRKVKRGDEPTSGEKENENLSSYVDSKNKN 732

Query: 224  E-NEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKE 282
            E N E  + + +    E E      +  E S  E  E++ +  + +K E    E  E + 
Sbjct: 733  EPNLEENENKRKSFSGESESESEKSINGEGSTSEESESESESEKSVKKEESTSEESESES 792

Query: 283  EKSQQENEETKDKENEE----IKNEVEDKEAGEVKEEKSRQEN---EETKDKENEEINQN 335
            EKS ++ E T ++   E    +K E    E  E + EKS ++     E  D E+E+  + 
Sbjct: 793  EKSVKKEESTSEESESESEKSVKKEESTSEESESESEKSVKKGGSTSEESDSESEKSAKK 852

Query: 336  GTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQE------EASSEKQVQDGEGNNE 389
            G       E   E+  K+E+  S  +E E EE  K  E      E+ SEK V+  E  +E
Sbjct: 853  GGSASGESESESEKSVKKEESTSEESETESEESKKKGEFKSKESESESEKSVKKEESTSE 912

Query: 390  QHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNE-VTDS 448
            +   E+        +   +S+    +S  K     +  ++ESE   +K G+ + E  ++S
Sbjct: 913  ESESESEKSVKKGGSTSEESESESEKSVKKGGSTSEESESESEKSVKKEGSTSEESESES 972

Query: 449  NATTNIQENGGENQAQTDNGSEKRSTSESG 478
              +   +E+  E      + +   + SE G
Sbjct: 973  EKSVKKEESTSEESESESDDNVVETQSEEG 1002



 Score =  108 bits (270), Expect = 6e-22
 Identities = 98/416 (23%), Positives = 185/416 (43%), Gaps = 49/416 (11%)

Query: 50   SAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEP 109
            S +    ++ + ++D + + E  T    +  E +E  E +   ++   +D+++S  + + 
Sbjct: 629  SVEYNKQLINISKQD-DSISESDTCSSEKEVEDNEYEERDDTKKDGNEIDKIDSKCDEDD 687

Query: 110  EHKPEEEHIKLDDANGV-----DENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEG 164
              + EE   K  + +G      DE     K  E++    ++ VD  +++  +L E+E + 
Sbjct: 688  NEEREEIITKEKNESGRKVKRGDEPTSGEKENENL----SSYVDSKNKNEPNLEENENKR 743

Query: 165  SSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQE 224
             S +  ++ ESE+ +   G  S+ +ES             + E+E         +K +  
Sbjct: 744  KSFSGESESESEKSINGEGSTSEESES-------------ESESEKS------VKKEEST 784

Query: 225  NEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEK 284
            +EE++ +  + +K E   +E  E + EKS ++ E T ++   E +  V  K+ G   EE 
Sbjct: 785  SEESESESEKSVKKEESTSEESESESEKSVKKEESTSEESESESEKSV--KKGGSTSEE- 841

Query: 285  SQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVE 344
            S  E+E++  K+      E E +    VK+E+S  E  ET   E+EE  + G        
Sbjct: 842  SDSESEKSA-KKGGSASGESESESEKSVKKEESTSEESET---ESEESKKKG-------- 889

Query: 345  ENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSA 404
               E  SKE + ES     +KEE    + E+ SEK V+ G   +E+   E+        +
Sbjct: 890  ---EFKSKESESESE-KSVKKEESTSEESESESEKSVKKGGSTSEESESESEKSVKKGGS 945

Query: 405  VDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGE 460
               +S+    +S  K     +  ++ESE +S K    T+E ++S +  N+ E   E
Sbjct: 946  TSEESESESEKSVKKEGSTSEESESESE-KSVKKEESTSEESESESDDNVVETQSE 1000



 Score =  100 bits (249), Expect = 2e-19
 Identities = 80/325 (24%), Positives = 163/325 (49%), Gaps = 29/325 (8%)

Query: 40   TNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQD--EESEH-------ES 90
            T EK  S G   K G++    G K+   L   ++ VD+++K +   EE+E+       ES
Sbjct: 696  TKEKNES-GRKVKRGDEPTS-GEKENENL---SSYVDSKNKNEPNLEENENKRKSFSGES 750

Query: 91   KTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDEN 150
            ++E + +++   S  E        E+ +K +++      E E++ E+ +K +++   +  
Sbjct: 751  ESESEKSINGEGSTSEESESESESEKSVKKEESTS---EESESESEKSVKKEESTSEESE 807

Query: 151  SEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAEN 210
            SE  + + + E    S +  ++ ESE+ V+K G  S+ ++S E++   K+      E+E+
Sbjct: 808  SESEKSVKKEE----STSEESESESEKSVKKGGSTSEESDS-ESEKSAKKGGSASGESES 862

Query: 211  KEAAEVHEEKSQQENEETKDKENE---EIKNEVEDTEAGEVKVEKSQQENEETKDKENEE 267
            +    V +E+S  E  ET+ +E++   E K++  ++E+ E  V+K +  +EE++ +  + 
Sbjct: 863  ESEKSVKKEESTSEESETESEESKKKGEFKSKESESES-EKSVKKEESTSEESESESEKS 921

Query: 268  IKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDK 327
            +K      E  E + EKS ++   T ++   E +  V  K+ G   EE S  E+E++  K
Sbjct: 922  VKKGGSTSEESESESEKSVKKGGSTSEESESESEKSV--KKEGSTSEE-SESESEKSVKK 978

Query: 328  ENEEINQNGTDVKDHVEENHEQDSK 352
            E     ++ ++  D+V E   ++ K
Sbjct: 979  EESTSEESESESDDNVVETQSEEGK 1003



 Score = 99.4 bits (246), Expect = 4e-19
 Identities = 96/360 (26%), Positives = 160/360 (43%), Gaps = 40/360 (11%)

Query: 49   ESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEES-----EHESKTEEQINLDE-VN 102
            ++ K GN++ ++  K      EE   +  + K +         E  S  +E  NL   V+
Sbjct: 668  DTKKDGNEIDKIDSKCDEDDNEEREEIITKEKNESGRKVKRGDEPTSGEKENENLSSYVD 727

Query: 103  SVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEG 162
            S ++NEP    EE   K    +G  E+E E            NG    SE S+   E E 
Sbjct: 728  SKNKNEPNL--EENENKRKSFSGESESESEKS---------INGEGSTSEESESESESEK 776

Query: 163  EGSSENA---RTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHE- 218
                E +    ++ ESE+ V+K    S+ +ES E++  VK+ E    E+E++    V + 
Sbjct: 777  SVKKEESTSEESESESEKSVKKEESTSEESES-ESEKSVKKEESTSEESESESEKSVKKG 835

Query: 219  ----EKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVED 274
                E+S  E+E++  K+      E E      VK E+S  E  ET+ +E+++ K E + 
Sbjct: 836  GSTSEESDSESEKSA-KKGGSASGESESESEKSVKKEESTSEESETESEESKK-KGEFKS 893

Query: 275  KEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQ 334
            KE+ E + EKS ++ E T ++   E +  V  K+ G   EE          + E+E+  +
Sbjct: 894  KES-ESESEKSVKKEESTSEESESESEKSV--KKGGSTSEE---------SESESEKSVK 941

Query: 335  NGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREE 394
             G    +  E   E+  K+E   S  +E+E E+  K +E  S E + +  +   E   EE
Sbjct: 942  KGGSTSEESESESEKSVKKEGSTSEESESESEKSVKKEESTSEESESESDDNVVETQSEE 1001


>UniRef100_Q7RJB3 Erythrocyte membrane-associated giant protein antigen 332 [Plasmodium
            yoelii yoelii]
          Length = 3404

 Score =  184 bits (466), Expect = 1e-44
 Identities = 163/770 (21%), Positives = 334/770 (43%), Gaps = 66/770 (8%)

Query: 49   ESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDE---ESEHESKTEEQINLDEVNSVD 105
            ES K  ND       + +  +  T V     K Q +   ESE E     +I+++ + +  
Sbjct: 618  ESIKNQNDTESESEIEEDEEITRTKVDVGSIKNQSDNEIESEEEEMARSEIDVESIKNQH 677

Query: 106  ENEPEHKPEEEHIK-----LDDANGVDENEVENKPEEHIKLD-DANGV----DENSEHSQ 155
            + E E + EEE I      +D      ++E+E + EE  +   D N +    D  SE  +
Sbjct: 678  DAESESESEEEEIAQSEIDVDSIENQSDSEIEEEEEEITRTKVDVNTIKNQSDTESEEEE 737

Query: 156  DLVEHEGEGSSENARTDIESEQHVEKVGEESD-NTESKENDSLVKE----NEENKHEAEN 210
             ++  E +  S   ++D E E+  E +  + D NT   ++D+ ++E    ++ N    +N
Sbjct: 738  GIIRSEIDADSIKNQSDSEIEEEEEIIRTKVDVNTIKNQSDNGIEEEIARSKINVGSVKN 797

Query: 211  KEAAEVHEEKSQQENEETK-DKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIK 269
            +  +E+  E+ + +  E   D    +   E E     E ++ +S+   E  K+K + E +
Sbjct: 798  QSDSEIESEEGEIDRSEIDIDSIKNQNDTESESESESEEEIARSKINVESIKNKNDAESE 857

Query: 270  NEVEDK------EAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEE 323
            NE E++      + G +K +   +  EE +++E E  ++E++    G +K +   +  EE
Sbjct: 858  NESEEEIARSKIDVGTIKNQNYAESEEEEEEEEEEIARSEID---VGSIKNQSDAESEEE 914

Query: 324  TKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQD 383
                  EEI +   DV              + +  N  E+E+EE  +I+ +  S K   D
Sbjct: 915  -----EEEITRTKVDV-----------GSIKNQSDNEIESEEEEMARIEIDVESIKNQHD 958

Query: 384  GEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETN 443
             E  +E   EE  A     +A      D  +ES ++ E++ ++E N S +++Q      N
Sbjct: 959  AESESENESEEEIARSKIDTATIKNQNDTESESESEEEEITRSEINVSSIKNQNDSESEN 1018

Query: 444  EVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNG 503
            E  +  A + +     +NQ   ++ SE++  + +    +  +N   ++    ++S  +  
Sbjct: 1019 EEEEEIARSEVNVESIKNQNYAESESEEKEIARNEIDVNSIKNQSDNE----IESEEEKI 1074

Query: 504  NETTSHTTDKQNETSEDANSKVED----SSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
              T  + +  ++++  ++ S+ E+    S  D  T K + + A+   ++       S   
Sbjct: 1075 IRTKVYVSRIKSQSYYESESEEEEEIARSDIDAATIKNQ-NYAENESENESENESESENE 1133

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEG-----KQDASHEAQLTASDTSSEQKKDESS 614
            S++ + N +  E+ N  + E    + +  G         S E  +T ++      K+++ 
Sbjct: 1134 SENESENESENESENESEEEEIARSKIDVGTIKNQNYAESEEEGITRNEIDVNSIKNQND 1193

Query: 615  NAETN--TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDV---SSEESKEGSSNSEN 669
            N   N   + +    VN +      +  +++  E  ++  S++   S E   +     E 
Sbjct: 1194 NESENEEEEEIARSEVNVESIKNQHDAESDNEIEEEEIAQSEIDVDSIENQSDSEIEEEE 1253

Query: 670  SSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSD 729
              +  +   + N   N N +   NE+E   +   +E D  + QN+S    + ++E A SD
Sbjct: 1254 EEEITRTKVDVNTIKNQNDTESENESEEE-EIDRNEIDVGSIQNQSDAESEEEEEIARSD 1312

Query: 730  -EGSNSNTNDQGSSSDPSITEEVKESHIDLGTLP-ESNAESNHRDVSSAE 777
             + + +   +   S + S  EE+ +S ID+G++  +SNAES   +++ +E
Sbjct: 1313 IDAATTKNQNYAESENESEEEEIDKSEIDVGSIQNQSNAESEKEEITRSE 1362



 Score =  167 bits (423), Expect = 1e-39
 Identities = 173/782 (22%), Positives = 340/782 (43%), Gaps = 102/782 (13%)

Query: 41   NEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDE 100
            N+ ++  GE A++  D   +  ++      +T   D    E + ESE E  T  +I +  
Sbjct: 1521 NQSESEEGEIARSDIDTATINNQN------DTESEDESENESENESEEEEITRSEIAVGS 1574

Query: 101  VNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEH 160
            +    +NE E   EEE I     N      ++NK       +DA   +E    S+  VE 
Sbjct: 1575 IKKQSDNEIES--EEEEITRTKIN---VESIKNK-------NDAESEEEEIARSEVNVE- 1621

Query: 161  EGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEK 220
                        I+++   E   EE + T +K + + +K   +N  E+E+KE  E+   +
Sbjct: 1622 -----------SIKNQNDTESESEEDEITRTKLDVNSIKN--QNDTESESKEEEEI--AR 1666

Query: 221  SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEI---KNEVEDKEA 277
            S+   +  K++ + EI++E E  +    KV  S+ +N+   + E EEI   K +V+  + 
Sbjct: 1667 SEVNVDPIKNQSDNEIESEEE--KIIRTKVYVSRIKNQSYYESEEEEITRTKIDVDPIKN 1724

Query: 278  GEVKEEKSQQENEETKDKEN-EEIKNEVEDKEAGEVKEE-------KSRQENEETKDKEN 329
                E +S++E E T+ + N   I+N+ E +E GE+          K++ + E   + E 
Sbjct: 1725 QNYAESESEEEEEITRSEVNVSRIQNQSESEE-GEIARSDMDAATIKNQNDTESENESEE 1783

Query: 330  EEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNE 389
            EE+ ++  DV    +++  +   EE+EE  G    + +   I+ ++ SE         NE
Sbjct: 1784 EEVAKSEIDVSSIKKQSDNEIESEEEEEEEGITRNEVDVSSIKNQSDSE---------NE 1834

Query: 390  QHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQ-KSGTETNEVTDS 448
               EE      A S V+ +S    N++ ++ +++ +NE + S +++Q +S +E  E+T S
Sbjct: 1835 SEEEEI-----ARSEVNVESIKNQNDTESEEDEITRNEIDVSSIKNQSESESEEEEITRS 1889

Query: 449  NATTNIQENGGENQAQTDNGSEKRSTSES-----GGQQHQEQNNPTSDGVETVDSSSQNG 503
                   +   +N+ + +  +  +  +ES       +  +E+   T   ++  +  +QN 
Sbjct: 1890 EIAVGSIKKQSDNEIEEEEIARTKINAESIKNKNDAESEEEEEGITRSEIDVNNIKNQND 1949

Query: 504  NETTSHTTDKQNE-------TSEDANSKVEDSST----DTTTPKTEDSNADAAGDD---- 548
             E+       Q+E          DA S+ E+  T    D  T K +  N   + ++    
Sbjct: 1950 TESEEEEEIAQSEIDVGSIKNQSDAESEEEEEITRTKVDVNTIKNQSDNEIESEEEKIIR 2009

Query: 549  ----VDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASD- 603
                V+     S   S+S       +   + ++N+N   +  +   +  S E ++T S+ 
Sbjct: 2010 TKVYVNRIKNQSYYESESEEEITRSEIDVSSIKNQNDTESENESESESESEEEEITRSEI 2069

Query: 604  --------TSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQV-NSSD 654
                    + +E ++ E +  + N +S++N N     S    EG   +  + S + N +D
Sbjct: 2070 DVGSIKKQSDNESEEKEITRTKINVESIKNKN--DAESEEEEEGITRNEIDVSSIKNQND 2127

Query: 655  VSSEESKEGSSNSENSSDANQN-GSNSNENDNGNASHDANENENSVQRKTSENDGEAAQN 713
              SE   E  S  E  + +  + GS   ++DN +   +    + +V+   ++ND E+ + 
Sbjct: 2128 TESENESESESEEEEIARSEIDVGSIKKQSDNESEEKEITRTKINVESIKNKNDAESEEE 2187

Query: 714  ESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDV 773
            E  E    ++E   S   + ++T  +  +   S  EE+  S ID+G++   +   +  DV
Sbjct: 2188 E--EEGITRNEIDVSSIKNQNDTESENENESESEEEEITRSEIDVGSIKNQSDAESEIDV 2245

Query: 774  SS 775
            +S
Sbjct: 2246 NS 2247



 Score =  167 bits (422), Expect = 1e-39
 Identities = 172/783 (21%), Positives = 333/783 (41%), Gaps = 109/783 (13%)

Query: 73   TVVDARHKEQDEESEHESKTEEQINLD-EVNSVD-----ENEPEHKPEEE--HIKLDDAN 124
            T VD    +   ++E ES+ EE   ++ +V S+      E+E E++ EEE    K+D A 
Sbjct: 921  TKVDVGSIKNQSDNEIESEEEEMARIEIDVESIKNQHDAESESENESEEEIARSKIDTAT 980

Query: 125  GVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTD-----IESEQHV 179
              ++N+ E++ E   +    + ++ +S  +Q+  E E E   E AR++     I+++ + 
Sbjct: 981  IKNQNDTESESESEEEEITRSEINVSSIKNQNDSESENEEEEEIARSEVNVESIKNQNYA 1040

Query: 180  EKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENE---ETKDKENEEI 236
            E   EE +   ++ + + +K   +N+ E+E ++        S+ +++   E++ +E EEI
Sbjct: 1041 ESESEEKEIARNEIDVNSIKNQSDNEIESEEEKIIRTKVYVSRIKSQSYYESESEEEEEI 1100

Query: 237  KNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKE 296
                 D +A  +K  ++  ENE   + ENE               E +++ ENE   + E
Sbjct: 1101 ARS--DIDAATIK-NQNYAENESENESENE--------------SESENESENESENESE 1143

Query: 297  NEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKE 356
            NE  +NE E++E    K +    +N+   + E E I +N  DV     +N  +   EE+E
Sbjct: 1144 NES-ENESEEEEIARSKIDVGTIKNQNYAESEEEGITRNEIDVNSIKNQNDNESENEEEE 1202

Query: 357  E-----------SNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAV 405
            E            N  +AE + + + +E A SE  V   E  ++   EE    +   + V
Sbjct: 1203 EIARSEVNVESIKNQHDAESDNEIEEEEIAQSEIDVDSIENQSDSEIEEEEEEEITRTKV 1262

Query: 406  D----HKSQDIFNESYNKTEQVDKNE------KNESEMESQK----SGTETNEVTDSNAT 451
            D        D  +E+ ++ E++D+NE      +N+S+ ES++    + ++ +  T  N  
Sbjct: 1263 DVNTIKNQNDTESENESEEEEIDRNEIDVGSIQNQSDAESEEEEEIARSDIDAATTKNQN 1322

Query: 452  TNIQENGGE---------------NQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETV 496
                EN  E               NQ+  ++  E+ + SE      + QN+  S+  E  
Sbjct: 1323 YAESENESEEEEIDKSEIDVGSIQNQSNAESEKEEITRSEINVNSIKNQNDSESENEEEE 1382

Query: 497  D--------SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDD 548
            +         S +N N+T S + +++    E A   ++  S +    + E+        D
Sbjct: 1383 EIARSEVNVESIKNQNDTESESEEEEIARYEIAVGSIKKQSDNEIESEEEEEGITRNEID 1442

Query: 549  VDSTYKSSSGNSDSNANNGAYKET---TNLVQNEN------------------PNGNSVQ 587
            V S    S   S++ +      ++    N ++N++                      S  
Sbjct: 1443 VSSIKNQSDVESENESEEKGITKSEIDVNSIKNQSYYESDEEKIIRTKVYVSRIKNQSYY 1502

Query: 588  EGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEA 647
            E +++    +++  S   ++ + +E   A ++ D+   +N N   S   SE  + +  E 
Sbjct: 1503 ESEEEEITRSEVDVSRIQNQSESEEGEIARSDIDTATINNQNDTESEDESENESENESEE 1562

Query: 648  SQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSEND 707
             ++  S+++    K+ S N   S +     +  N     N  +DA   E  + R  SE +
Sbjct: 1563 EEITRSEIAVGSIKKQSDNEIESEEEEITRTKINVESIKN-KNDAESEEEEIAR--SEVN 1619

Query: 708  GEAAQNES-VESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNA 766
             E+ +N++  ESE  +DE   +    NS  N   + S+    EE+  S +++   P  N 
Sbjct: 1620 VESIKNQNDTESESEEDEITRTKLDVNSIKNQNDTESESKEEEEIARSEVNVD--PIKNQ 1677

Query: 767  ESN 769
              N
Sbjct: 1678 SDN 1680



 Score =  158 bits (400), Expect = 5e-37
 Identities = 181/848 (21%), Positives = 357/848 (41%), Gaps = 126/848 (14%)

Query: 34   VYQIKHTN--EKKASYGESAKTGNDVVRLGRKDLNPLVEE------TTVVDARHKEQDEE 85
            V  IK+ N  E ++   E A+   DV  +  +  N +  E      T V  +R K Q   
Sbjct: 1031 VESIKNQNYAESESEEKEIARNEIDVNSIKNQSDNEIESEEEKIIRTKVYVSRIKSQSYY 1090

Query: 86   SEHESKTEEQINLDEVNSVD-ENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDD- 143
             E ES+ EE+I   ++++   +N+   + E E+   +++   +E+E E++ E   + ++ 
Sbjct: 1091 -ESESEEEEEIARSDIDAATIKNQNYAENESENESENESESENESENESENESENESENE 1149

Query: 144  -------ANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDS 196
                    + +D  +  +Q+  E E EG + N   D+ S ++      E++  E      
Sbjct: 1150 SEEEEIARSKIDVGTIKNQNYAESEEEGITRN-EIDVNSIKNQNDNESENEEEEEIARSE 1208

Query: 197  LVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEV---KVE-- 251
            +  E+ +N+H+AE+    E+ EE+  Q   +    EN+   +E+E+ E  E+   KV+  
Sbjct: 1209 VNVESIKNQHDAESDN--EIEEEEIAQSEIDVDSIENQS-DSEIEEEEEEEITRTKVDVN 1265

Query: 252  --KSQQENEETKDKENEEI-KNEVEDKEAGEVKEEKSQQENE---------ETKDKENEE 299
              K+Q + E   + E EEI +NE++        + +S++E E          TK++   E
Sbjct: 1266 TIKNQNDTESENESEEEEIDRNEIDVGSIQNQSDAESEEEEEIARSDIDAATTKNQNYAE 1325

Query: 300  IKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEE-- 357
             +NE E++E  + + +    +N+   + E EEI ++  +V     +N  +   EE+EE  
Sbjct: 1326 SENESEEEEIDKSEIDVGSIQNQSNAESEKEEITRSEINVNSIKNQNDSESENEEEEEIA 1385

Query: 358  -----------SNGTEAEKEEQ--GKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSA 404
                        N TE+E EE+   + +    S K+  D E  +E+  E     +   S+
Sbjct: 1386 RSEVNVESIKNQNDTESESEEEEIARYEIAVGSIKKQSDNEIESEEEEEGITRNEIDVSS 1445

Query: 405  VDHKSQDIFNESYNKTEQVDKNE------KNESEMESQKS------------------GT 440
            + ++S D+ +E+ ++ + + K+E      KN+S  ES +                    +
Sbjct: 1446 IKNQS-DVESENESEEKGITKSEIDVNSIKNQSYYESDEEKIIRTKVYVSRIKNQSYYES 1504

Query: 441  ETNEVTDSNATTNIQENGGENQA---------------QTDNGSEKRSTSESGGQQHQEQ 485
            E  E+T S    +  +N  E++                Q D  SE  S +ES  +  +E+
Sbjct: 1505 EEEEITRSEVDVSRIQNQSESEEGEIARSDIDTATINNQNDTESEDESENESENESEEEE 1564

Query: 486  NNPTSDGVETVDSSSQN--------------GNETTSHTTDKQNETSEDANSKVEDSS-- 529
               +   V ++   S N                E+  +  D ++E  E A S+V   S  
Sbjct: 1565 ITRSEIAVGSIKKQSDNEIESEEEEITRTKINVESIKNKNDAESEEEEIARSEVNVESIK 1624

Query: 530  -TDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQE 588
              + T  ++E+        DV+S    +   S+S       +   N+   +N + N ++ 
Sbjct: 1625 NQNDTESESEEDEITRTKLDVNSIKNQNDTESESKEEEEIARSEVNVDPIKNQSDNEIES 1684

Query: 589  GKQDASHEAQLTA---SDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNK 645
             ++         +   + +  E +++E +  + + D ++N N         SE    +  
Sbjct: 1685 EEEKIIRTKVYVSRIKNQSYYESEEEEITRTKIDVDPIKNQNY------AESESEEEEEI 1738

Query: 646  EASQVNSSDVSSE-ESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTS 704
              S+VN S + ++ ES+EG     +   A     N  E++N +   +  ++E  V     
Sbjct: 1739 TRSEVNVSRIQNQSESEEGEIARSDMDAATIKNQNDTESENESEEEEVAKSEIDVSSIKK 1798

Query: 705  ENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPES 764
            ++D     NE    E+ ++E    +E   S+  +Q  S + S  EE+  S +++ ++   
Sbjct: 1799 QSD-----NEIESEEEEEEEGITRNEVDVSSIKNQSDSENESEEEEIARSEVNVESIKNQ 1853

Query: 765  NAESNHRD 772
            N   +  D
Sbjct: 1854 NDTESEED 1861



 Score =  158 bits (400), Expect = 5e-37
 Identities = 183/820 (22%), Positives = 352/820 (42%), Gaps = 105/820 (12%)

Query: 34   VYQIKHTNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTE 93
            V  IK+ N+ ++   E  +       + R ++N  VE  ++ +    E D E E E   +
Sbjct: 1185 VNSIKNQNDNESENEEEEE-------IARSEVN--VE--SIKNQHDAESDNEIEEEEIAQ 1233

Query: 94   EQINLDEVNSVDENEPEHKPEEE--HIKLDDANGVDENEVENKPEEHIKLDDANGVDENS 151
             +I++D + +  ++E E + EEE    K+D     ++N+ E++ E   +  D N +D  S
Sbjct: 1234 SEIDVDSIENQSDSEIEEEEEEEITRTKVDVNTIKNQNDTESENESEEEEIDRNEIDVGS 1293

Query: 152  EHSQDLVEHEGEGSSENARTDIE---------SEQHVEKVGEESDNTESKENDSLVKENE 202
              +Q   + E E   E AR+DI+         +E   E   EE D +E        + N 
Sbjct: 1294 IQNQS--DAESEEEEEIARSDIDAATTKNQNYAESENESEEEEIDKSEIDVGSIQNQSNA 1351

Query: 203  ENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEV--------EDTEAGEVKVE--- 251
            E++ E   +    V+  K+Q ++E   ++E E  ++EV         DTE+   + E   
Sbjct: 1352 ESEKEEITRSEINVNSIKNQNDSESENEEEEEIARSEVNVESIKNQNDTESESEEEEIAR 1411

Query: 252  --------KSQQENEETKDKENEEI-KNEVEDKEAGEVKEEKSQQENEETKDKENEEIKN 302
                    K Q +NE   ++E E I +NE++        + +S+ E+EE    ++E   N
Sbjct: 1412 YEIAVGSIKKQSDNEIESEEEEEGITRNEIDVSSIKNQSDVESENESEEKGITKSEIDVN 1471

Query: 303  EVEDKEAGEVKEEK--------SRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEE 354
             ++++   E  EEK        SR +N+   + E EEI ++  DV     +N  +  + E
Sbjct: 1472 SIKNQSYYESDEEKIIRTKVYVSRIKNQSYYESEEEEITRSEVDVSR--IQNQSESEEGE 1529

Query: 355  KEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFN 414
               S+   A    Q   + E  SE      E  NE   EE    + A  ++  +S    N
Sbjct: 1530 IARSDIDTATINNQNDTESEDESE-----NESENESEEEEITRSEIAVGSIKKQSD---N 1581

Query: 415  ESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRST 474
            E  ++ E++ + + N   +++ K+  E+ E   + +  N++    +N  ++++  ++ + 
Sbjct: 1582 EIESEEEEITRTKINVESIKN-KNDAESEEEEIARSEVNVESIKNQNDTESESEEDEITR 1640

Query: 475  SESGGQQHQEQNNPTSDGVETVDSSSQNGN-ETTSHTTDKQNETSED--ANSKVEDSS-T 530
            ++      + QN+  S+  E  + +    N +   + +D + E+ E+    +KV  S   
Sbjct: 1641 TKLDVNSIKNQNDTESESKEEEEIARSEVNVDPIKNQSDNEIESEEEKIIRTKVYVSRIK 1700

Query: 531  DTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQE-G 589
            + +  ++E+        DVD     +   S+S       +   N+ + +N + +   E  
Sbjct: 1701 NQSYYESEEEEITRTKIDVDPIKNQNYAESESEEEEEITRSEVNVSRIQNQSESEEGEIA 1760

Query: 590  KQDASHEAQLTASDTSSEQKKDESSNAETNTD----SVQNDNVNSDGSNTNSEGSANDNK 645
            + D         +DT SE + +E   A++  D      Q+DN          EG   +  
Sbjct: 1761 RSDMDAATIKNQNDTESENESEEEEVAKSEIDVSSIKKQSDNEIESEEEEEEEGITRNEV 1820

Query: 646  EASQV-NSSDVSSEESKEGSSNSENSSDA--NQNGSNSNENDNGNASHDANENENSVQRK 702
            + S + N SD  +E  +E  + SE + ++  NQN + S E++      D +  +N  + +
Sbjct: 1821 DVSSIKNQSDSENESEEEEIARSEVNVESIKNQNDTESEEDEITRNEIDVSSIKNQSESE 1880

Query: 703  TSE----------------NDGEAAQNE------SVESEKAKD--ESAHSDEGSNSNTND 738
            + E                +D E  + E      + ES K K+  ES   +EG   +  D
Sbjct: 1881 SEEEEITRSEIAVGSIKKQSDNEIEEEEIARTKINAESIKNKNDAESEEEEEGITRSEID 1940

Query: 739  QGSSSDPSIT-----EEVKESHIDLGTLP-ESNAESNHRD 772
              +  + + T     EE+ +S ID+G++  +S+AES   +
Sbjct: 1941 VNNIKNQNDTESEEEEEIAQSEIDVGSIKNQSDAESEEEE 1980



 Score =  154 bits (388), Expect = 1e-35
 Identities = 175/843 (20%), Positives = 351/843 (40%), Gaps = 123/843 (14%)

Query: 37   IKHTNEKKASYGE-----SAKTGNDVVRLGRKDLNPLVEETTVVDARHK-EQDEESEHES 90
            +K+ N KK    +     S    ND+  L R+  +   EE    D  +  + D  SE + 
Sbjct: 361  LKNVNRKKELITDFSDRVSINENNDI--LEREFCDADDEEEDDSDPSYDIDSDMGSEADV 418

Query: 91   KTEEQINL-------------------DEVNSVDENEPEHKPEEEHIKLDDANGVDENEV 131
            + EE  NL                   +E+N +++ E      ++ I+L+D+   D+N  
Sbjct: 419  EVEENSNLIENNTYISKNKHDNFVKKSNEINILNDIEQITSKPKDLIELNDSGFYDKNIN 478

Query: 132  ENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTES 191
            +N+ +           D +   S    E + E S     T+  +   VE V +    +E+
Sbjct: 479  KNESDYAESTQGERNEDRDIPTSLSRKEIDVESSD----TEEGTHGQVESVVDSQSESEN 534

Query: 192  KENDSLVKENEENKHEAENKEAAEVHEEKSQQENEET-KDKENEEIKNEVEDTEAGEVKV 250
            ++ D +     + +HE+ ++E  E  + K  + +  T K++ + EI++E E+    E+ V
Sbjct: 535  EKEDGV----SDIEHESASEEEIEPRKVKHNEIDAGTIKNQSDSEIESEEEEIAQSEIDV 590

Query: 251  E--KSQQENEETKDKENEEIKNEVED----KEAGEVKEEKSQQENEE----------TKD 294
            E  K+Q + E   + E EEI     D    K   + + E   +E+EE           K+
Sbjct: 591  ESIKNQHDAESESESEEEEIAQSEIDVESIKNQNDTESESEIEEDEEITRTKVDVGSIKN 650

Query: 295  KENEEIKNEVEDKEAGEVKEE--KSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSK 352
            + + EI++E E+    E+  E  K++ + E   + E EEI Q+  DV D +E   + + +
Sbjct: 651  QSDNEIESEEEEMARSEIDVESIKNQHDAESESESEEEEIAQSEIDV-DSIENQSDSEIE 709

Query: 353  EEKEESNGTEAE------------KEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDN 400
            EE+EE   T+ +            +EE+G I+ E  ++      +   E+  E      +
Sbjct: 710  EEEEEITRTKVDVNTIKNQSDTESEEEEGIIRSEIDADSIKNQSDSEIEEEEEIIRTKVD 769

Query: 401  ASSAVDHKSQDIFNE-SYNKTEQVDKNEKNESEMESQKSGTETNEV-TDSNATTNIQENG 458
             ++  +     I  E + +K        +++SE+ES++   + +E+  DS    N  E+ 
Sbjct: 770  VNTIKNQSDNGIEEEIARSKINVGSVKNQSDSEIESEEGEIDRSEIDIDSIKNQNDTESE 829

Query: 459  GENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGV--ETVDSSSQNGNETTSHTTDKQNE 516
             E++++ +    K +      +   E  N + + +    +D  +           +++ E
Sbjct: 830  SESESEEEIARSKINVESIKNKNDAESENESEEEIARSKIDVGTIKNQNYAESEEEEEEE 889

Query: 517  TSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLV 576
              E A S+++  S    +    D+ ++   +++  T K   G+  + ++N    E   + 
Sbjct: 890  EEEIARSEIDVGSIKNQS----DAESEEEEEEITRT-KVDVGSIKNQSDNEIESEEEEMA 944

Query: 577  -----------------QNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
                             ++EN +   +   K D +       +++ SE +++E + +E N
Sbjct: 945  RIEIDVESIKNQHDAESESENESEEEIARSKIDTATIKNQNDTESESESEEEEITRSEIN 1004

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
              S++N N +S+  N   E  A        + + + +  ES+E    + N  D N   S 
Sbjct: 1005 VSSIKNQN-DSESENEEEEEIARSEVNVESIKNQNYAESESEE-KEIARNEIDVN---SI 1059

Query: 680  SNENDN-------------------GNASHDANENENSVQRKTSENDGEAAQNESVESEK 720
             N++DN                    + S+  +E+E   +   S+ D    +N++    +
Sbjct: 1060 KNQSDNEIESEEEKIIRTKVYVSRIKSQSYYESESEEEEEIARSDIDAATIKNQNYAENE 1119

Query: 721  AKDESAHSDEGSNSNTND-----QGSSSDPSITEEVKESHIDLGTLPESN-AESNHRDVS 774
            +++ES +  E  N + N+     +  S + S  EE+  S ID+GT+   N AES    ++
Sbjct: 1120 SENESENESESENESENESENESENESENESEEEEIARSKIDVGTIKNQNYAESEEEGIT 1179

Query: 775  SAE 777
              E
Sbjct: 1180 RNE 1182



 Score =  144 bits (364), Expect = 8e-33
 Identities = 167/764 (21%), Positives = 326/764 (41%), Gaps = 126/764 (16%)

Query: 73   TVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGV-----D 127
            T +D    +    +E ES+ EE+I   EVN V   + + + EE  I   D +       +
Sbjct: 1715 TKIDVDPIKNQNYAESESEEEEEITRSEVN-VSRIQNQSESEEGEIARSDMDAATIKNQN 1773

Query: 128  ENEVENKPEEH-----------IKLDDANGVD-ENSEHSQDLVEHEGEGSSENARTDIES 175
            + E EN+ EE            IK    N ++ E  E  + +  +E + SS   ++D E+
Sbjct: 1774 DTESENESEEEEVAKSEIDVSSIKKQSDNEIESEEEEEEEGITRNEVDVSSIKNQSDSEN 1833

Query: 176  EQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEE 235
            E   E++     N ES +N        +N  E+E  E      + S  +N+   + E EE
Sbjct: 1834 ESEEEEIARSEVNVESIKN--------QNDTESEEDEITRNEIDVSSIKNQSESESEEEE 1885

Query: 236  I-KNEV--------EDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQ 286
            I ++E+         D E  E ++ +++   E  K+K + E + E E     E+     +
Sbjct: 1886 ITRSEIAVGSIKKQSDNEIEEEEIARTKINAESIKNKNDAESEEEEEGITRSEIDVNNIK 1945

Query: 287  QENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKD-HVEE 345
             +N+   ++E E  ++E+   + G +K +   +  EE      EEI +   DV     + 
Sbjct: 1946 NQNDTESEEEEEIAQSEI---DVGSIKNQSDAESEEE------EEITRTKVDVNTIKNQS 1996

Query: 346  NHEQDSKEEK-----------EESNGTEAEKEEQ-GKIQEEASSEKQVQDGEGNNEQHRE 393
            ++E +S+EEK           +  +  E+E EE+  + + + SS K   D E  NE   E
Sbjct: 1997 DNEIESEEEKIIRTKVYVNRIKNQSYYESESEEEITRSEIDVSSIKNQNDTESENESESE 2056

Query: 394  -ENYAGDNASSAVDHKSQDIFNESYNKTEQVD-----------KNEKNESEMESQKSGTE 441
             E+   +   S +D  S  I  +S N++E+ +           KN KN++E E ++ G  
Sbjct: 2057 SESEEEEITRSEIDVGS--IKKQSDNESEEKEITRTKINVESIKN-KNDAESEEEEEGIT 2113

Query: 442  TNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQ 501
             NE+ D ++  N  +   EN++++++  E+ + SE      ++Q++  S+  E   + ++
Sbjct: 2114 RNEI-DVSSIKNQNDTESENESESESEEEEIARSEIDVGSIKKQSDNESEEKEI--TRTK 2170

Query: 502  NGNETTSHTTDKQNETSED---ANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
               E+  +  D ++E  E+     ++++ SS         ++  ++  ++ + T      
Sbjct: 2171 INVESIKNKNDAESEEEEEEGITRNEIDVSSIKNQNDTESENENESESEEEEITRSEIDV 2230

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE- 617
             S  N ++   +   N ++N+N + +  +E + D+         DT SE+++ E S +E 
Sbjct: 2231 GSIKNQSDAESEIDVNSIKNQNDSESGNEEEEIDSIKNYGGDGEDTESEEEEKEESESED 2290

Query: 618  --TNTDSVQNDNV----NSDGSNTNSE------------GSANDN------KEASQVNSS 653
               N +  + + +      +G   +              GS  +N      KE   +NS 
Sbjct: 2291 VDVNLEMERKEGIKIIDTKEGEQMHKSQIELMDLEKEEIGSVENNKLTIKGKEPEYINSH 2350

Query: 654  DVSSE---ESKEGSSNSE-NSSDANQNGSNSNENDNGNASHDANE--------------- 694
            ++  E    +KE   NSE   S++N       +N N   + D N+               
Sbjct: 2351 EIRKEVCASNKEPKMNSEIKVSNSNDQKKTYRDNQNSLCTFDYNKQKYFPILKEKIKKLN 2410

Query: 695  ---NENSVQRKTSENDGEAAQNESVESEKAKDE-SAHSDEGSNS 734
               +E S++++  +ND +  +    E+++  DE +   +EG  S
Sbjct: 2411 NKIDEYSIRKQVKKNDEKNEEENDEENDEENDEKNDEKNEGEKS 2454



 Score =  138 bits (347), Expect = 7e-31
 Identities = 155/746 (20%), Positives = 317/746 (41%), Gaps = 95/746 (12%)

Query: 69   VEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHI-----KLDDA 123
            ++  T+ +    E + ESE E   + +I++  +    +NE E + EEE       ++D +
Sbjct: 1764 MDAATIKNQNDTESENESEEEEVAKSEIDVSSIKKQSDNEIESEEEEEEEGITRNEVDVS 1823

Query: 124  NGVDENEVENKPEEH------IKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQ 177
            +  ++++ EN+ EE       + ++     ++      ++  +E + SS   +++ ESE+
Sbjct: 1824 SIKNQSDSENESEEEEIARSEVNVESIKNQNDTESEEDEITRNEIDVSSIKNQSESESEE 1883

Query: 178  H--------VEKVGEESDNTESKENDSLVKENEE---NKHEAENKEAAE--------VHE 218
                     V  + ++SDN   +E  +  K N E   NK++AE++E  E        V+ 
Sbjct: 1884 EEITRSEIAVGSIKKQSDNEIEEEEIARTKINAESIKNKNDAESEEEEEGITRSEIDVNN 1943

Query: 219  EKSQQENEETKDKENEE-------IKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNE 271
             K+Q + E  +++E  +       IKN+ +     E ++ +++ +    K++ + EI++E
Sbjct: 1944 IKNQNDTESEEEEEIAQSEIDVGSIKNQSDAESEEEEEITRTKVDVNTIKNQSDNEIESE 2003

Query: 272  VEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEE 331
             E     +V   + + ++    + E E  ++E++        + +S  E+E   + E EE
Sbjct: 2004 EEKIIRTKVYVNRIKNQSYYESESEEEITRSEIDVSSIKNQNDTESENESESESESEEEE 2063

Query: 332  INQNGTDVKDHVEENHEQDSKEEK-----------EESNGTEAEKEEQGKIQEE--ASSE 378
            I ++  DV   +++  + +S+E++           +  N  E+E+EE+G  + E   SS 
Sbjct: 2064 ITRSEIDVGS-IKKQSDNESEEKEITRTKINVESIKNKNDAESEEEEEGITRNEIDVSSI 2122

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVD-----------KNE 427
            K   D E  NE   E     + A S +D  S  I  +S N++E+ +           KN+
Sbjct: 2123 KNQNDTESENESESESEEE-EIARSEIDVGS--IKKQSDNESEEKEITRTKINVESIKNK 2179

Query: 428  KNESEMESQKSGTETNEVTDSNATT-NIQENGGENQAQTDNGSEKRSTSESGGQQHQEQN 486
             +    E ++ G   NE+  S+    N  E+  EN+++++     RS  + G  ++Q   
Sbjct: 2180 NDAESEEEEEEGITRNEIDVSSIKNQNDTESENENESESEEEEITRSEIDVGSIKNQ--- 2236

Query: 487  NPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAG 546
               SD    +D +S   N+  S + +++ E     N   +   T++   + E+S ++   
Sbjct: 2237 ---SDAESEIDVNSIK-NQNDSESGNEEEEIDSIKNYGGDGEDTESEEEEKEESESEDVD 2292

Query: 547  DDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDA---------SHEA 597
             +++   K      D+      +K    L+  E     SV+  K            SHE 
Sbjct: 2293 VNLEMERKEGIKIIDTKEGEQMHKSQIELMDLEKEEIGSVENNKLTIKGKEPEYINSHEI 2352

Query: 598  QLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSS 657
            +     ++ E K     N+E    +  ND   +   N NS  + + NK+        +  
Sbjct: 2353 RKEVCASNKEPKM----NSEIKVSN-SNDQKKTYRDNQNSLCTFDYNKQ----KYFPILK 2403

Query: 658  EESKEGSSNSENSSDANQ----NGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQN 713
            E+ K+ ++  +  S   Q    +  N  END  N   +  +N+   + + S+N      N
Sbjct: 2404 EKIKKLNNKIDEYSIRKQVKKNDEKNEEENDEENDEENDEKNDEKNEGEKSKNVISFYNN 2463

Query: 714  ESVESEKAKDESAHSDEGSNSNTNDQ 739
                  K    + + +E  +  +N Q
Sbjct: 2464 LKKNMLKENYHNKNCEENESIKSNKQ 2489



 Score =  135 bits (339), Expect = 6e-30
 Identities = 156/717 (21%), Positives = 306/717 (41%), Gaps = 105/717 (14%)

Query: 34   VYQIKHTNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTV-----VDARHKEQDEESEH 88
            V  IK+ N+ ++   E  +   DV  +  +  +   EE        V +  K+ D E E 
Sbjct: 1847 VESIKNQNDTESEEDEITRNEIDVSSIKNQSESESEEEEITRSEIAVGSIKKQSDNEIEE 1906

Query: 89   ESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVD 148
            E     +IN + + +  +N+ E + EEE I   +   +D N ++N+             D
Sbjct: 1907 EEIARTKINAESIKN--KNDAESEEEEEGITRSE---IDVNNIKNQN------------D 1949

Query: 149  ENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEA 208
              SE  +++ + E +  S   ++D ESE       EE + T +K + + +K   +N+ E+
Sbjct: 1950 TESEEEEEIAQSEIDVGSIKNQSDAESE-------EEEEITRTKVDVNTIKNQSDNEIES 2002

Query: 209  ENKEAAEVHEEKSQQENEETKDKENEE--IKNEVEDTEAGEVKVEKSQQENEETKDKENE 266
            E ++        ++ +N+   + E+EE   ++E++ +        +S+ E+E   + E E
Sbjct: 2003 EEEKIIRTKVYVNRIKNQSYYESESEEEITRSEIDVSSIKNQNDTESENESESESESEEE 2062

Query: 267  EIKNEVEDKEAGEVKEEKSQQENEETKDKEN-EEIKNEVEDKEAGEVKEEKSRQENEETK 325
            EI     D  + + + +   +E E T+ K N E IKN+  D E+ E +E  +R E + + 
Sbjct: 2063 EITRSEIDVGSIKKQSDNESEEKEITRTKINVESIKNK-NDAESEEEEEGITRNEIDVSS 2121

Query: 326  DKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGE 385
             K     NQN T      E  +E +S+ E+EE   +E +     K  +  S EK++   +
Sbjct: 2122 IK-----NQNDT------ESENESESESEEEEIARSEIDVGSIKKQSDNESEEKEITRTK 2170

Query: 386  GNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQ---KSGTET 442
             N E  + +N          D +S++   E   + E    + KN+++ ES+   +S +E 
Sbjct: 2171 INVESIKNKN----------DAESEEEEEEGITRNEIDVSSIKNQNDTESENENESESEE 2220

Query: 443  NEVTDSNATTNIQENGGENQAQTD-NGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQ 501
             E+T S       +N  + +++ D N  + ++ SESG ++ +         ++++ +   
Sbjct: 2221 EEITRSEIDVGSIKNQSDAESEIDVNSIKNQNDSESGNEEEE---------IDSIKNYGG 2271

Query: 502  NGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSD 561
            +G +T S   +K+   SED +  +E    +              G  +  T +    +  
Sbjct: 2272 DGEDTESEEEEKEESESEDVDVNLEMERKE--------------GIKIIDTKEGEQMHKS 2317

Query: 562  SNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTD 621
                    KE    V+N N      +E +   SHE +     ++ E K     N+E    
Sbjct: 2318 QIELMDLEKEEIGSVEN-NKLTIKGKEPEYINSHEIRKEVCASNKEPK----MNSEIKV- 2371

Query: 622  SVQNDNVNSDGSNTNSEGSANDNKEA-------------SQVNSSDVSSEESKEGSSNSE 668
            S  ND   +   N NS  + + NK+              ++++   +  +  K    N E
Sbjct: 2372 SNSNDQKKTYRDNQNSLCTFDYNKQKYFPILKEKIKKLNNKIDEYSIRKQVKKNDEKNEE 2431

Query: 669  NSSDAN--QNGSNSNENDNGNASHDANENENSVQR---KTSENDGEAAQNESVESEK 720
             + + N  +N   ++E + G  S +     N++++   K + ++    +NES++S K
Sbjct: 2432 ENDEENDEENDEKNDEKNEGEKSKNVISFYNNLKKNMLKENYHNKNCEENESIKSNK 2488



 Score =  124 bits (311), Expect = 1e-26
 Identities = 168/791 (21%), Positives = 323/791 (40%), Gaps = 115/791 (14%)

Query: 43   KKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVN 102
            K  SY ES     + +     D++ +  +         E + ESE E  T  +I++  + 
Sbjct: 2018 KNQSYYESES--EEEITRSEIDVSSIKNQNDTESENESESESESEEEEITRSEIDVGSIK 2075

Query: 103  SVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEG 162
               +NE E K E    K++  +  ++N+ E++ EE  +    N +D +S  +Q+  E E 
Sbjct: 2076 KQSDNESEEK-EITRTKINVESIKNKNDAESEEEE--EGITRNEIDVSSIKNQNDTESEN 2132

Query: 163  EGSSENARTDI-ESEQHVEKVGEESDNTESKENDSLVKENEE---NKHEAENKEAAEV-- 216
            E  SE+   +I  SE  V  + ++SDN   ++  +  K N E   NK++AE++E  E   
Sbjct: 2133 ESESESEEEEIARSEIDVGSIKKQSDNESEEKEITRTKINVESIKNKNDAESEEEEEEGI 2192

Query: 217  ---HEEKSQQENEETKDKENE-EIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEV 272
                 + S  +N+   + ENE E ++E E+    E+ V   + +++   + +   IKN+ 
Sbjct: 2193 TRNEIDVSSIKNQNDTESENENESESEEEEITRSEIDVGSIKNQSDAESEIDVNSIKNQ- 2251

Query: 273  EDKEAGEVKEEKSQQENE--ETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKD-KEN 329
             D E+G  +EE    +N   + +D E+EE + E  + E  +V  E  R+E  +  D KE 
Sbjct: 2252 NDSESGNEEEEIDSIKNYGGDGEDTESEEEEKEESESEDVDVNLEMERKEGIKIIDTKEG 2311

Query: 330  EEINQNGTDVKD-------HVEENHEQDSKEEKEESNGTEAEKEEQGKIQE-EASSEKQV 381
            E+++++  ++ D        VE N      +E E  N  E  KE     +E + +SE +V
Sbjct: 2312 EQMHKSQIELMDLEKEEIGSVENNKLTIKGKEPEYINSHEIRKEVCASNKEPKMNSEIKV 2371

Query: 382  QDGEGNNEQHREENYAGDNASSAVDHKSQDIFN-------------ESYNKTEQVDKNEK 428
             +     + +R+      N+    D+  Q  F              + Y+  +QV KN++
Sbjct: 2372 SNSNDQKKTYRDNQ----NSLCTFDYNKQKYFPILKEKIKKLNNKIDEYSIRKQVKKNDE 2427

Query: 429  NESEMESQKSGTETNEVTD---------------SNATTNIQENGGENQAQTDNGSEKRS 473
               E   +++  E +E  D               +N   N+ +    N+   +N S K S
Sbjct: 2428 KNEEENDEENDEENDEKNDEKNEGEKSKNVISFYNNLKKNMLKENYHNKNCEENESIK-S 2486

Query: 474  TSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTD---KQNETSEDANSKVEDSST 530
              +    ++  +     +G    +    N  +   +  D   K+ +   + N+   +S  
Sbjct: 2487 NKQIANLRNVIKKKNLLNGYNFSEIKIDNDKKEIYNKNDISLKRKKNIYNKNNYYCNSHK 2546

Query: 531  DTTTP----KTEDSNADAAGDDVDSTYKS---SSGNSDSNANNGAYKET----TNLVQNE 579
            + + P    K ++ N     ++ D+   +   ++ N++++ NN  YK+       L   +
Sbjct: 2547 NDSIPIQINKNKNINIKINSNNFDNNIDNIINNNNNNNNDYNNNDYKDNDYKDNKLYNIK 2606

Query: 580  NPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDN-VNSDGSNTNSE 638
            N    +++E +   S  + LT    +   K+ ++++  ++  +  N   + +D  N N+ 
Sbjct: 2607 NEKYINIEEHETICSFSSILTDKKNNKIFKETKTNDKYSDISNFGNYTFIGNDIINKNAT 2666

Query: 639  GSANDNKEASQVNSSDVSSEESKEGSSNSE------------------------------ 668
               N+N       S  V + E+ E   N E                              
Sbjct: 2667 FEKNNNTTNYIHQSEKVGNVENVEKVENVEKVGKVGNVEKVEKVEKVGKVEKPDSDKHFD 2726

Query: 669  ------NSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDG----EAAQNESVES 718
                  N    N   S   + +NGN + +  +N N+ + K + N      +   NE +ES
Sbjct: 2727 IIEGIINRKCLNHGYSKYFDTENGNINDNVCDNNNNNRAKQNLNLNFKFEKGNNNECLES 2786

Query: 719  EKAKDESAHSD 729
             K K+    SD
Sbjct: 2787 LKKKNNDPKSD 2797



 Score = 88.6 bits (218), Expect = 7e-16
 Identities = 156/744 (20%), Positives = 283/744 (37%), Gaps = 123/744 (16%)

Query: 76   DARHKEQDEESEHESKTEE-QINLD-------EVNSVDENEPEHKPEEEHIKLD--DANG 125
            D    E +EE + ES++E+  +NL+       ++    E E  HK + E + L+  +   
Sbjct: 2272 DGEDTESEEEEKEESESEDVDVNLEMERKEGIKIIDTKEGEQMHKSQIELMDLEKEEIGS 2331

Query: 126  VDENE--VENKPEEHIKLDD------ANGVDE--NSE----HSQDLVEHEGEGSSENART 171
            V+ N+  ++ K  E+I   +      A+  +   NSE    +S D  +   +  +     
Sbjct: 2332 VENNKLTIKGKEPEYINSHEIRKEVCASNKEPKMNSEIKVSNSNDQKKTYRDNQNSLCTF 2391

Query: 172  DIESEQHV----EKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEE 227
            D   +++     EK+ + ++  +       VK+N+E K+E EN       +E++ +EN+E
Sbjct: 2392 DYNKQKYFPILKEKIKKLNNKIDEYSIRKQVKKNDE-KNEEEN-------DEENDEENDE 2443

Query: 228  TKDKENEEIK--------NEVEDTEAGEVKVEKSQQENEETK-DKENEEIKNEVEDKEA- 277
              D++NE  K        N ++     E    K+ +ENE  K +K+   ++N ++ K   
Sbjct: 2444 KNDEKNEGEKSKNVISFYNNLKKNMLKENYHNKNCEENESIKSNKQIANLRNVIKKKNLL 2503

Query: 278  -----GEVKEEKSQQE-------------------NEETKDKENEEIKNEVEDKEAGEVK 313
                  E+K +  ++E                   N      +N+ I  ++   +   +K
Sbjct: 2504 NGYNFSEIKIDNDKKEIYNKNDISLKRKKNIYNKNNYYCNSHKNDSIPIQINKNKNINIK 2563

Query: 314  EEKSRQEN---EETKDKENEEINQNGTDVKDH-VEENHEQDSKEEK----EE-----SNG 360
               +  +N       +  N   + N  D KD+  ++N   + K EK    EE     S  
Sbjct: 2564 INSNNFDNNIDNIINNNNNNNNDYNNNDYKDNDYKDNKLYNIKNEKYINIEEHETICSFS 2623

Query: 361  TEAEKEEQGKIQEEASSEKQVQDGE--------GNNEQHREENYAGDNASSAVDHKSQDI 412
            +    ++  KI +E  +  +  D          GN+  ++   +  +N ++   H+S+ +
Sbjct: 2624 SILTDKKNNKIFKETKTNDKYSDISNFGNYTFIGNDIINKNATFEKNNNTTNYIHQSEKV 2683

Query: 413  FN-ESYNKTEQVDKNEK--NESEMES-QKSGTETNEVTDSNATTNIQENGGENQAQTDNG 468
             N E+  K E V+K  K  N  ++E  +K G    E  DS+   +I E G  N+   ++G
Sbjct: 2684 GNVENVEKVENVEKVGKVGNVEKVEKVEKVGKV--EKPDSDKHFDIIE-GIINRKCLNHG 2740

Query: 469  SEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDS 528
              K   +E+G       +N  +      + + QN N          NE  E    K  D 
Sbjct: 2741 YSKYFDTENGNINDNVCDNNNN------NRAKQNLNLNFKFEKGNNNECLESLKKKNNDP 2794

Query: 529  STDTTTPKTEDSNADAAGDDVDSTYKSSSGN--------SDSNANNGAYKETTNLVQNEN 580
             +D    K         G  +D+ Y   +GN        S +    G  K   N V+   
Sbjct: 2795 KSDVLEKK---------GPQIDAAYSMHNGNQNIVDKLESKNACKKGDKKLGKNKVEKNK 2845

Query: 581  PNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGS 640
               N V++ K + +   +        EQ K E +  E N         N    N   +  
Sbjct: 2846 VEQNKVEQNKVEKNKIEKNKVEKNKVEQNKVEKNKVEQNKVEQNKVEQNKVEQNKVEQNK 2905

Query: 641  ANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQ 700
               NK   + N  + +  E  +   N    +   QN    N+ +      +  E     Q
Sbjct: 2906 VEQNK--MEQNKIEKNKVEKNKVEKNKVEKNKVEQNKVEQNKVEQNKIEKNKVEKNKVEQ 2963

Query: 701  RKTSENDGEAAQNESVESEKAKDE 724
             K  +N  E  + E  + EK K E
Sbjct: 2964 NKVEQNKVEQNKMEQNKMEKNKVE 2987



 Score = 82.0 bits (201), Expect = 6e-14
 Identities = 132/611 (21%), Positives = 247/611 (39%), Gaps = 90/611 (14%)

Query: 76   DARHKEQDEESEHESKTEEQINLDEVNSV---------DENEPEHKPEEEHIKLDDANGV 126
            D +  +  +   +  K E+ IN++E  ++          +N    K  + + K  D +  
Sbjct: 2591 DYKDNDYKDNKLYNIKNEKYINIEEHETICSFSSILTDKKNNKIFKETKTNDKYSDISNF 2650

Query: 127  DE-----NEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEK 181
                   N++ NK             ++N+  +  + + E  G+ EN    +E  ++VEK
Sbjct: 2651 GNYTFIGNDIINKNATF---------EKNNNTTNYIHQSEKVGNVEN----VEKVENVEK 2697

Query: 182  VGEES--DNTESKENDSLVKENEENKH----------EAENKEAAEVHEEKSQQENEETK 229
            VG+    +  E  E    V++ + +KH          +  N   ++  + ++   N+   
Sbjct: 2698 VGKVGNVEKVEKVEKVGKVEKPDSDKHFDIIEGIINRKCLNHGYSKYFDTENGNINDNVC 2757

Query: 230  DKENEEIKNEVEDTEAGEVKVEK-SQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQE 288
            D  N    N  +       K EK +  E  E+  K+N + K++V +K+  ++    S   
Sbjct: 2758 DNNNN---NRAKQNLNLNFKFEKGNNNECLESLKKKNNDPKSDVLEKKGPQIDAAYSMHN 2814

Query: 289  -NEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENH 347
             N+   DK   +   +  DK+ G+ K EK++ E  +    E  ++ +N  + K+ VE+N 
Sbjct: 2815 GNQNIVDKLESKNACKKGDKKLGKNKVEKNKVEQNKV---EQNKVEKNKIE-KNKVEKNK 2870

Query: 348  EQDSKEEKE--ESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAV 405
             + +K EK   E N  E  K EQ K+++    + +V+  +   EQ++ E        + V
Sbjct: 2871 VEQNKVEKNKVEQNKVEQNKVEQNKVEQNKVEQNKVE--QNKMEQNKIEK-------NKV 2921

Query: 406  DHKSQDIFNESYNKTEQVDKNEKNESEMES-QKSGTETNEVTDSNATTN-IQENGGENQA 463
            +    +      NK EQ +K E+N+ E    +K+  E N+V  +    N +++N  E   
Sbjct: 2922 EKNKVEKNKVEKNKVEQ-NKVEQNKVEQNKIEKNKVEKNKVEQNKVEQNKVEQNKMEQNK 2980

Query: 464  QTDNGSEKRSTSESGGQQHQEQNNPTS-----DGVET-------------VDSSSQNGNE 505
               N  E+    ++  +Q++ + N          +ET             V  S  + + 
Sbjct: 2981 MEKNKVEQNKVEQNKVEQNKMEQNKMEKLCKIKSLETHNLPYNKLLNDMCVSKSKPSSDL 3040

Query: 506  TTSHTTDKQNETSEDANSKVE------DSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
                 TDK ++ SE     VE        S D+    T+    +   +D +S    +S N
Sbjct: 3041 FEISETDKISKASETCLKLVEIKQLESKISKDSVHDNTKMLMCNNKINDYNSKICENSNN 3100

Query: 560  SDSNANNGAY-KETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
               N N   Y KET   ++ E    N +   K++   E ++   + S +  K +  N E 
Sbjct: 3101 HKLNKNLILYIKETYLKLKKEKQYNNML--FKENKKLENKVRLLNQSKKIYKKKIKNLEK 3158

Query: 619  NTDSVQNDNVN 629
            N D  QN   N
Sbjct: 3159 NCDE-QNKITN 3168



 Score = 81.6 bits (200), Expect = 8e-14
 Identities = 91/384 (23%), Positives = 173/384 (44%), Gaps = 58/384 (15%)

Query: 34   VYQIKHTNEKKA---SYGESAKTGNDVVRLG---RKDLNPLVEETTVVDARHKEQDEESE 87
            +++   TN+K +   ++G     GND++       K+ N            + E  E+ E
Sbjct: 2634 IFKETKTNDKYSDISNFGNYTFIGNDIINKNATFEKNNNTTNYIHQSEKVGNVENVEKVE 2693

Query: 88   HESKTEEQINLDEVNSVDENEPEHKPE-EEHIKL------------------DDANG--- 125
            +  K  +  N+++V  V++     KP+ ++H  +                  D  NG   
Sbjct: 2694 NVEKVGKVGNVEKVEKVEKVGKVEKPDSDKHFDIIEGIINRKCLNHGYSKYFDTENGNIN 2753

Query: 126  --VDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVG 183
              V +N   N+ ++++ L+       N+E  + L +   +  S+           +EK G
Sbjct: 2754 DNVCDNNNNNRAKQNLNLNFKFEKGNNNECLESLKKKNNDPKSDV----------LEKKG 2803

Query: 184  EESDNTESKENDSLVKENEENKHEAEN------KEAAEVHEEKSQQEN---EETKDKENE 234
             + D   S  N +   +N  +K E++N      K+  +   EK++ E    E+ K ++N+
Sbjct: 2804 PQIDAAYSMHNGN---QNIVDKLESKNACKKGDKKLGKNKVEKNKVEQNKVEQNKVEKNK 2860

Query: 235  EIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQEN-EETK 293
              KN+VE  +  + KVEK++ E  + +  + E+ K E    E  +V++ K +Q   E+ K
Sbjct: 2861 IEKNKVEKNKVEQNKVEKNKVEQNKVEQNKVEQNKVEQNKVEQNKVEQNKMEQNKIEKNK 2920

Query: 294  DKENEEIKNEVEDK--EAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDS 351
             ++N+  KN+VE    E  +V++ K  Q   E    E  ++ QN  + ++ VE+N  + +
Sbjct: 2921 VEKNKVEKNKVEKNKVEQNKVEQNKVEQNKIEKNKVEKNKVEQNKVE-QNKVEQNKMEQN 2979

Query: 352  KEEKE--ESNGTEAEKEEQGKIQE 373
            K EK   E N  E  K EQ K+++
Sbjct: 2980 KMEKNKVEQNKVEQNKVEQNKMEQ 3003



 Score = 55.8 bits (133), Expect = 5e-06
 Identities = 71/384 (18%), Positives = 150/384 (38%), Gaps = 52/384 (13%)

Query: 408 KSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDN 467
           K + +    +N  + V++ ++  ++   + S  E N++ +        E   ++    D 
Sbjct: 349 KPKRLLASVFNVLKNVNRKKELITDFSDRVSINENNDILEREFCDADDEEEDDSDPSYDI 408

Query: 468 GSEKRSTSESGGQQHQEQ-NNPTSDGVETVDSSSQNGNETT-----SHTTDKQNETSEDA 521
            S+  S ++   +++     N T       D+  +  NE          T K  +  E  
Sbjct: 409 DSDMGSEADVEVEENSNLIENNTYISKNKHDNFVKKSNEINILNDIEQITSKPKDLIELN 468

Query: 522 NSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSD---SNANNGAYKETTNLVQN 578
           +S   D + +       +S      +D D     S    D   S+   G + +  ++V +
Sbjct: 469 DSGFYDKNINKNESDYAESTQGERNEDRDIPTSLSRKEIDVESSDTEEGTHGQVESVVDS 528

Query: 579 ENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSE 638
           ++ + N  ++G  D  HE+   AS+   E +K + +  +  T   Q+D            
Sbjct: 529 QSESENEKEDGVSDIEHES---ASEEEIEPRKVKHNEIDAGTIKNQSD------------ 573

Query: 639 GSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENS 698
                         S++ SEE +   S  +  S  NQ+ +   E+++ +   +  ++E  
Sbjct: 574 --------------SEIESEEEEIAQSEIDVESIKNQHDA---ESESESEEEEIAQSEID 616

Query: 699 VQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDL 758
           V+   ++ND E+      ESE  +DE     +    +  +Q  +   S  EE+  S ID+
Sbjct: 617 VESIKNQNDTES------ESEIEEDEEITRTKVDVGSIKNQSDNEIESEEEEMARSEIDV 670

Query: 759 GTL-----PESNAESNHRDVSSAE 777
            ++      ES +ES   +++ +E
Sbjct: 671 ESIKNQHDAESESESEEEEIAQSE 694



 Score = 45.8 bits (107), Expect = 0.005
 Identities = 88/435 (20%), Positives = 173/435 (39%), Gaps = 91/435 (20%)

Query: 41   NEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDE 100
            N+ + +  E  K   + V   + + N  VE+  V   + ++   E     K + + N  E
Sbjct: 2909 NKMEQNKIEKNKVEKNKVEKNKVEKNK-VEQNKVEQNKVEQNKIEKNKVEKNKVEQNKVE 2967

Query: 101  VNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHS------ 154
             N V++N+ E    E++ K++  N V++N+VE    E  K++    +     H+      
Sbjct: 2968 QNKVEQNKMEQNKMEKN-KVEQ-NKVEQNKVEQNKMEQNKMEKLCKIKSLETHNLPYNKL 3025

Query: 155  -QDLVEHEGEGSS---ENARTD------------IESEQHVEKVGEES--DNTE-----S 191
              D+   + + SS   E + TD            +E +Q   K+ ++S  DNT+     +
Sbjct: 3026 LNDMCVSKSKPSSDLFEISETDKISKASETCLKLVEIKQLESKISKDSVHDNTKMLMCNN 3085

Query: 192  KENDSLVKENEENKHEAENKEAAEVHEE-----KSQQENEETKDKENEEIKNEVEDTEAG 246
            K ND   K  E + +   NK      +E     K +++      KEN++++N+V      
Sbjct: 3086 KINDYNSKICENSNNHKLNKNLILYIKETYLKLKKEKQYNNMLFKENKKLENKVRLLNQS 3145

Query: 247  EVKVEKSQQENEETKDKENEE-------------IKNEVEDKEAGEVKEEKSQQENE--- 290
            +   +K  +  E+  D++N+              +KN   +    +VK + +  EN    
Sbjct: 3146 KKIYKKKIKNLEKNCDEQNKITNKFENIMNNFNLLKNSKMEIPMDDVKMQNAYIENTIGQ 3205

Query: 291  -------------------------ETKDKENE-EIKNEVEDKEAGEVKEEKSRQENEET 324
                                       ++K  E ++ N++++    +  EE ++ +NE  
Sbjct: 3206 LYHILRHFRRKHXIPKRIENLGSVYAKREKGIELQLNNQIKNLNLLKKYEETTQTKNEYF 3265

Query: 325  KD------------KENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQ 372
            K+            K  E+I +N  D+K  + EN ++    + E S      KE + K  
Sbjct: 3266 KELQKKEKDIINLNKNLEDIMKNTNDMKQMLVENDDKLKNLKMELSQKNTIIKELEEKNN 3325

Query: 373  EEASSEKQVQDGEGN 387
            +   +EK +Q  + N
Sbjct: 3326 KLMENEKVMQTEKEN 3340



 Score = 43.9 bits (102), Expect = 0.018
 Identities = 88/430 (20%), Positives = 169/430 (38%), Gaps = 95/430 (22%)

Query: 69   VEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD--DANGV 126
            VE+  V   + ++   E     K + + N  E N V++N+ E    E+  K+   + + +
Sbjct: 2961 VEQNKVEQNKVEQNKMEQNKMEKNKVEQNKVEQNKVEQNKMEQNKMEKLCKIKSLETHNL 3020

Query: 127  DENEVEN-------KPEEHI-KLDDANGVDENSEHSQDLVEH---EGEGSSENARTDIES 175
              N++ N       KP   + ++ + + + + SE    LVE    E + S ++   + + 
Sbjct: 3021 PYNKLLNDMCVSKSKPSSDLFEISETDKISKASETCLKLVEIKQLESKISKDSVHDNTKM 3080

Query: 176  -------EQHVEKVGEESDN-------------------TESKENDSLVKENE--ENKHE 207
                     +  K+ E S+N                    E + N+ L KEN+  ENK  
Sbjct: 3081 LMCNNKINDYNSKICENSNNHKLNKNLILYIKETYLKLKKEKQYNNMLFKENKKLENKVR 3140

Query: 208  AEN------KEAAEVHEEKSQQENEETKDKEN-----EEIKNEVEDTEAGEVKVEKSQQE 256
              N      K+  +  E+   ++N+ T   EN       +KN   +    +VK++ +  E
Sbjct: 3141 LLNQSKKIYKKKIKNLEKNCDEQNKITNKFENIMNNFNLLKNSKMEIPMDDVKMQNAYIE 3200

Query: 257  N--------------EETKDKENEEIKNEVEDKEAG-------EVKEEKSQQENEETKDK 295
            N              +    K  E + +    +E G       ++K     ++ EET   
Sbjct: 3201 NTIGQLYHILRHFRRKHXIPKRIENLGSVYAKREKGIELQLNNQIKNLNLLKKYEETTQT 3260

Query: 296  ENEEIKNEVEDKEAGEVKEEKSRQ--------------ENEETKDKENEEINQNGTDVKD 341
            +NE  K E++ KE   +   K+ +              EN++       E++Q  T +K+
Sbjct: 3261 KNEYFK-ELQKKEKDIINLNKNLEDIMKNTNDMKQMLVENDDKLKNLKMELSQKNTIIKE 3319

Query: 342  HVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNA 401
              E+N++    E+  ++      +   GK +E+ ++ K+ +D E    Q + +NY   N 
Sbjct: 3320 LEEKNNKLMENEKVMQTEKENLLELLYGK-EEKLATAKEYKD-EIKELQQKIKNYLHKNV 3377

Query: 402  SSAVDHKSQD 411
                 HK QD
Sbjct: 3378 -----HKVQD 3382


>UniRef100_P97399 Dentin sialophosphoprotein precursor (Dentin matrix protein-3)
           (DMP-3) [Contains: Dentin phosphoprotein (Dentin
           phosphophoryn) (DPP); Dentin sialoprotein (DSP)] [Mus
           musculus]
          Length = 934

 Score =  181 bits (460), Expect = 6e-44
 Identities = 178/829 (21%), Positives = 353/829 (42%), Gaps = 111/829 (13%)

Query: 48  GESAKTGNDVVRLGRKDLNPLVEETTVVDARHK----EQDEESEHESKTEEQINLD---- 99
           G +A+  ND+   G   ++   E +T    R +    E  EE+E     +   N      
Sbjct: 107 GNTAEEHNDIETYGHDGVHARGENSTANGIRSQVGIVENAEEAESSVHGQAGQNTKSGGA 166

Query: 100 -------EVNSVDENEPEH---KPEEEHIKLDDANGVDENEVENKPE------------- 136
                  +   V ENEP     K    H      +GV  +E   + E             
Sbjct: 167 SDVSQNGDATLVQENEPPEASIKNSTNHEAGIHGSGVATHETTPQREGLGSENQGTEVTP 226

Query: 137 ---EHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESD--NTES 191
              E   LDD +G    +   +D     G+G    A    ES    +  G +S   NT+ 
Sbjct: 227 SIGEDAGLDDTDGSPSGNGVEEDEDTGSGDGEGAEAGDGRESHDGTKGQGGQSHGGNTDH 286

Query: 192 KENDSLVKENEENK--------HEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDT 243
           +   S+  E++++K        H  +N  ++E +  +     + T+DKE    K +  D 
Sbjct: 287 RGQSSVSTEDDDSKEQEGFPNGHNGDN--SSEENGVEEGDSTQATQDKEKLSPK-DTRDA 343

Query: 244 EAGEVKVE------KSQQENEETK--DKENEEIKNEVEDKEAGEVKEEKSQQENEETK-D 294
           E G +         KSQ +  ET+  +K N+ I      KE+G++   K    ++  + D
Sbjct: 344 EGGIISQSEACPSGKSQDQGIETEGPNKGNKSIIT----KESGKLSGSKDSNGHQGVELD 399

Query: 295 KENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEE 354
           K N   + E  DK  G    EKS   +     +     N +G D  +  +E+ + D  + 
Sbjct: 400 KRNSPKQGE-SDKPQGTA--EKSAAHSNLGHSRIGSSSNSDGHDSYEFDDESMQGDDPKS 456

Query: 355 KEESNGTEAEK------EEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHK 408
            +ESNG++          E G   + + +  +  D + +++ H  E+ + D++S   D  
Sbjct: 457 SDESNGSDESDTNSESANESGSRGDASYTSDESSDDDNDSDSHAGEDDSSDDSSGDGDSD 516

Query: 409 SQ-DIFNESYNKTEQVDKNEKNESEMESQKSGTETNE----------------------- 444
           S  D  +ES +K E    +  N S+ ES+   +++++                       
Sbjct: 517 SNGDGDSESEDKDESDSSDHDNSSDSESKSDSSDSSDDSSDSSDSSDSSDSSDSSDSSDS 576

Query: 445 -----VTDSNATTNIQENGGENQAQ-------TDNGSEKRSTSESGGQQHQEQNNPTSDG 492
                 +DSN++++  ++ G + +        + + S+   +S+S        ++ +SD 
Sbjct: 577 SDSSDSSDSNSSSDSSDSSGSSDSSDSSDTCDSSDSSDSSDSSDSSDSSDSSDSSDSSDS 636

Query: 493 VETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDST 552
            ++ DSSS + +  +S  +D  + +    +S   DSS  +++  +  SN+  + D  DS+
Sbjct: 637 SDSSDSSSSSDSSDSSSCSDSSDSSDSSDSSDSSDSSDSSSSDSSSSSNSSDSSDSSDSS 696

Query: 553 YKS----SSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQ 608
             S    SS +SDS+ ++G+   + +   +++ + +   +    +       +SD+S   
Sbjct: 697 SSSDSSDSSDSSDSSDSSGSSDSSDSSASSDSSSSSDSSDSSSSSDSSDSSDSSDSSDSS 756

Query: 609 KKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSE 668
           +  +SSN+  ++DS  + + +    +++S  S++ +  +   +SSD S       SS+S 
Sbjct: 757 ESSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSS 816

Query: 669 NSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHS 728
           +SSD++ +  +S+ +D+ ++S  ++ +++S    +S++   +  ++S +S  + D S  S
Sbjct: 817 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 876

Query: 729 DEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
           D  SNS+ +    S D S      +S    G   +SN++SN    S +E
Sbjct: 877 D-SSNSSDSSDSDSKDSSSDSSDGDSKSGNGN-SDSNSDSNSDSDSDSE 923



 Score =  156 bits (395), Expect = 2e-36
 Identities = 114/672 (16%), Positives = 296/672 (43%), Gaps = 57/672 (8%)

Query: 40  TNEKKASYGESAKTGNDVVRLGRKDLNP-----LVEETTVVDARHKEQDEESEHESKTEE 94
           + E     G+S +   D  +L  KD        + +       + ++Q  E+E  +K  +
Sbjct: 315 SEENGVEEGDSTQATQDKEKLSPKDTRDAEGGIISQSEACPSGKSQDQGIETEGPNKGNK 374

Query: 95  QINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHS 154
            I   E   +  ++  +    + ++LD  N   + E  +KP+           ++++ HS
Sbjct: 375 SIITKESGKLSGSKDSNG--HQGVELDKRNSPKQGE-SDKPQ--------GTAEKSAAHS 423

Query: 155 QDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAA 214
              + H   GSS N+  D       +    + D+ +S +  +   E++ N   A    + 
Sbjct: 424 N--LGHSRIGSSSNS--DGHDSYEFDDESMQGDDPKSSDESNGSDESDTNSESANESGSR 479

Query: 215 EVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVED 274
                 S + +++  D ++   +++  D  +G+   + +   + E++DK+  +  ++ ++
Sbjct: 480 GDASYTSDESSDDDNDSDSHAGEDDSSDDSSGDGDSDSNGDGDSESEDKDESD-SSDHDN 538

Query: 275 KEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQ 334
               E K + S   ++ +   ++ +  +  +  ++ +  +     ++  + D  +   + 
Sbjct: 539 SSDSESKSDSSDSSDDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNSSSDSSDSSGSS 598

Query: 335 NGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREE 394
           + +D  D  + +   DS +  + S+ +++          ++S      D           
Sbjct: 599 DSSDSSDTCDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSSSSD----------- 647

Query: 395 NYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNI 454
             + D++S +    S D    S + ++  D ++ + S+  S  + +++++ +DS+++++ 
Sbjct: 648 --SSDSSSCSDSSDSSD----SSDSSDSSDSSDSSSSDSSSSSNSSDSSDSSDSSSSSD- 700

Query: 455 QENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQ 514
                     + + S+   +S+S G      ++ +SD   + DSS  + +  +S ++D  
Sbjct: 701 ----------SSDSSDSSDSSDSSGSSDSSDSSASSDSSSSSDSSDSSSSSDSSDSSD-- 748

Query: 515 NETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTN 574
              S D++   E S +  ++  ++ S++  + D  DS+  S S +S +++++    ++++
Sbjct: 749 ---SSDSSDSSESSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSD 805

Query: 575 LVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSN 634
              + N + +S      D+S  +   +SD+S      +SS++  ++DS  + + +    +
Sbjct: 806 SSDSSNSSDSSDSSDSSDSSDSSD--SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDS 863

Query: 635 TNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANE 694
           ++S  S++ +  +   NSSD S  +SK+ SS+S +    + NG NS+ N + N+  D++ 
Sbjct: 864 SDSSDSSDSSDSSDSSNSSDSSDSDSKDSSSDSSDGDSKSGNG-NSDSNSDSNSDSDSDS 922

Query: 695 NENSVQRKTSEN 706
             +     TS++
Sbjct: 923 EGSDSNHSTSDD 934



 Score = 97.8 bits (242), Expect = 1e-18
 Identities = 122/553 (22%), Positives = 220/553 (39%), Gaps = 82/553 (14%)

Query: 297 NEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKE 356
           N    N  +  +  E+ E+   ++  +     +E I+  G D        +EQ +  E+ 
Sbjct: 54  NSTTSNSNDSPDGSEIGEQVLSEDGYKRDGNGSESIHVGGKDFPTQPILVNEQGNTAEEH 113

Query: 357 ESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNES 416
               T        + +   ++  + Q G   N +  E +  G    +     + D+    
Sbjct: 114 NDIETYGHDGVHARGENSTANGIRSQVGIVENAEEAESSVHGQAGQNTKSGGASDVSQNG 173

Query: 417 ----YNKTEQVDKNEKNESEMES--QKSGTETNEVT-------DSNATTNIQENGGENQA 463
                 + E  + + KN +  E+    SG  T+E T         N  T +  + GE+  
Sbjct: 174 DATLVQENEPPEASIKNSTNHEAGIHGSGVATHETTPQREGLGSENQGTEVTPSIGEDAG 233

Query: 464 QTD-------NGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNE 516
             D       NG E+   + SG  +  E      DG E+ D +   G ++    TD + +
Sbjct: 234 LDDTDGSPSGNGVEEDEDTGSGDGEGAE----AGDGRESHDGTKGQGGQSHGGNTDHRGQ 289

Query: 517 TS---EDANSKVE---------DSSTD-------TTTPKTED-------SNADAAGDDVD 550
           +S   ED +SK +         D+S++        +T  T+D          DA G  + 
Sbjct: 290 SSVSTEDDDSKEQEGFPNGHNGDNSSEENGVEEGDSTQATQDKEKLSPKDTRDAEGGIIS 349

Query: 551 STYKSSSGNSDSNA------NNG----AYKETTNLVQNENPNG---------NSVQEGKQ 591
            +    SG S          N G      KE+  L  +++ NG         NS ++G+ 
Sbjct: 350 QSEACPSGKSQDQGIETEGPNKGNKSIITKESGKLSGSKDSNGHQGVELDKRNSPKQGES 409

Query: 592 D--------ASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSAND 643
           D        ++  + L  S   S    D   + E + +S+Q D+  S   +  S+ S  +
Sbjct: 410 DKPQGTAEKSAAHSNLGHSRIGSSSNSDGHDSYEFDDESMQGDDPKSSDESNGSDESDTN 469

Query: 644 NKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKT 703
           ++ A++  S   +S  S E SS+ +N SD++    +S+++ +G+   D+N + +S     
Sbjct: 470 SESANESGSRGDASYTSDE-SSDDDNDSDSHAGEDDSSDDSSGDGDSDSNGDGDSESEDK 528

Query: 704 SENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPE 763
            E+D     N S +SE   D S  SD+ S+S  +D   SSD S + +  +S  D     +
Sbjct: 529 DESDSSDHDNSS-DSESKSDSSDSSDDSSDS--SDSSDSSDSSDSSDSSDSS-DSSDSSD 584

Query: 764 SNAESNHRDVSSA 776
           SN+ S+  D S +
Sbjct: 585 SNSSSDSSDSSGS 597



 Score = 40.4 bits (93), Expect = 0.20
 Identities = 56/255 (21%), Positives = 92/255 (35%), Gaps = 35/255 (13%)

Query: 529 STDTTTPKTEDS-NADAAGDDV--DSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNS 585
           S ++TT  + DS +    G+ V  +  YK     S+S    G    T  ++ NE  N   
Sbjct: 52  SINSTTSNSNDSPDGSEIGEQVLSEDGYKRDGNGSESIHVGGKDFPTQPILVNEQGNTAE 111

Query: 586 VQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSA---- 641
                +   H+      + S+            N +  ++      G NT S G++    
Sbjct: 112 EHNDIETYGHDGVHARGENSTANGIRSQVGIVENAEEAESSVHGQAGQNTKSGGASDVSQ 171

Query: 642 ---------NDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN--------SNEND 684
                    N+  EAS  NS++  +     G +  E +      GS         S   D
Sbjct: 172 NGDATLVQENEPPEASIKNSTNHEAGIHGSGVATHETTPQREGLGSENQGTEVTPSIGED 231

Query: 685 NGNASHDANENENSVQ--RKTSENDGEAAQ----NESVESEKAKDESAHSDEGSNSNTND 738
            G    D + + N V+    T   DGE A+     ES +  K +   +H       NT+ 
Sbjct: 232 AGLDDTDGSPSGNGVEEDEDTGSGDGEGAEAGDGRESHDGTKGQGGQSH-----GGNTDH 286

Query: 739 QGSSSDPSITEEVKE 753
           +G SS  +  ++ KE
Sbjct: 287 RGQSSVSTEDDDSKE 301



 Score = 36.2 bits (82), Expect = 3.8
 Identities = 45/223 (20%), Positives = 90/223 (40%), Gaps = 31/223 (13%)

Query: 564 ANNGAYKETTNLVQNENPNGNSVQEG-------KQDASHEAQLTASD----TSSEQKKDE 612
           A N     +T    N++P+G+ + E        K+D +    +        T      ++
Sbjct: 47  AQNELSINSTTSNSNDSPDGSEIGEQVLSEDGYKRDGNGSESIHVGGKDFPTQPILVNEQ 106

Query: 613 SSNAETNTD--SVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENS 670
            + AE + D  +  +D V++ G N+ + G  +          ++ S       ++ S  +
Sbjct: 107 GNTAEEHNDIETYGHDGVHARGENSTANGIRSQVGIVENAEEAESSVHGQAGQNTKSGGA 166

Query: 671 SDANQNGSNS--NENDNGNAS------HDANENENSV--QRKTSENDGEAAQNE------ 714
           SD +QNG  +   EN+   AS      H+A  + + V     T + +G  ++N+      
Sbjct: 167 SDVSQNGDATLVQENEPPEASIKNSTNHEAGIHGSGVATHETTPQREGLGSENQGTEVTP 226

Query: 715 SVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITE--EVKESH 755
           S+  +   D++  S  G+    ++   S D    E  + +ESH
Sbjct: 227 SIGEDAGLDDTDGSPSGNGVEEDEDTGSGDGEGAEAGDGRESH 269


>UniRef100_Q8MTN7 Glutamic acid-rich protein cNBL1700 [Trichinella spiralis]
          Length = 571

 Score =  178 bits (451), Expect = 6e-43
 Identities = 133/512 (25%), Positives = 250/512 (47%), Gaps = 38/512 (7%)

Query: 59  RLGRKDLNPLVEETTVVDARHKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHI 118
           R G  D     +ETTV++   KE +   + E  T ++ + ++ +   E E E K  +E  
Sbjct: 68  REGNSDDICTEDETTVIE---KESENGVDKEKPTSKEESGEKTSQ--EKESEEKSSQE-- 120

Query: 119 KLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQ- 177
           K +D +  + +E ++  +E    ++    +E+ +  ++    E  GSSE    D   EQ 
Sbjct: 121 KDEDKSESEASEEKDVSQEQNSKEEKGASEEDEDTPEEQNSKEENGSSEEDDEDASEEQA 180

Query: 178 -HVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEI 236
            + EK   E  NT S+E     +E +E K +    E  E    + Q   E   ++E+EE 
Sbjct: 181 SNEEKEASEEKNTVSEERKGASEEEDEEKDDGHESEV-ESQASEEQTTEEGASEEEDEES 239

Query: 237 KNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDK- 295
            +E E T  GE K    ++E +E  ++E+ E++++  +++  E +E  S++E+EE + K 
Sbjct: 240 ASE-EQTSEGEEKGASQEEEEDEGNEQES-EVESQASEEQTSEEEESASEEEDEENESKE 297

Query: 296 ---ENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSK 352
              E EE  +E ED+E+   +EEK+  + EE +D+ NE   Q   + +   EE  E+   
Sbjct: 298 QTTEEEESASEEEDEESASEREEKNASQEEE-EDEGNESKEQTTEEEESASEEEDEESVS 356

Query: 353 EEK----EESNGTEAEKEEQGKIQ----EEASSEKQVQDGEGNNEQHREENYAGDNAS-- 402
           EE+    EE   ++ E+E++G  Q    E  +SE+Q  + EG +E+  EEN + +  +  
Sbjct: 357 EEQTSEGEEKGASQEEEEDEGNDQESEVESQASEEQTSEEEGASEEEDEENESEEQTTEE 416

Query: 403 -SAVDHKSQDIFNESYNKT----EQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQEN 457
            SA + + ++  +E   K     E+ D+  + ESE+ESQ S  +T+E  +    +  ++ 
Sbjct: 417 ESASEEEDEESASEGEEKNASQEEEEDEGNEQESEVESQASEEQTSEEEEKEGASQEEDE 476

Query: 458 GGENQAQTDNGSEKRSTSESG------GQQHQEQNNPTSDGVETVDSSSQNGNETTSHTT 511
             E++ QT    E+ ++ E         Q  +E+    +   E  D  ++  +E  S  +
Sbjct: 477 ENESEEQTSEEEEEGASEEEDEESAFEEQTSEEEEEKGASQEEEEDEENEQESEVESQAS 536

Query: 512 DKQNETSEDANSKVEDSSTDTTTPKTEDSNAD 543
           ++Q    E A+ + +D+S +    ++E+  +D
Sbjct: 537 EEQTSEEEGASEEGQDASEEEDEDESEEEESD 568



 Score =  176 bits (445), Expect = 3e-42
 Identities = 133/543 (24%), Positives = 253/543 (46%), Gaps = 40/543 (7%)

Query: 217 HEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKE 276
           H E    +  + K K+ E   +++  TE     +EK   E+E   DKE    K E  +K 
Sbjct: 52  HSEDRYDDGVDRKWKKREGNSDDI-CTEDETTVIEK---ESENGVDKEKPTSKEESGEKT 107

Query: 277 AGEVK-EEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQN 335
           + E + EEKS QE +E  DK   E   E +  +    KEEK   E +E   +E     +N
Sbjct: 108 SQEKESEEKSSQEKDE--DKSESEASEEKDVSQEQNSKEEKGASEEDEDTPEEQNSKEEN 165

Query: 336 GTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQ-----VQDGEGNNEQ 390
           G+  +D  + + EQ S EEKE S       EE+    EE   EK        + + + EQ
Sbjct: 166 GSSEEDDEDASEEQASNEEKEASEEKNTVSEERKGASEEEDEEKDDGHESEVESQASEEQ 225

Query: 391 HREENYAGD-NASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSN 449
             EE  + + +  SA + ++ +   +  ++ E+ D+  + ESE+ESQ S  +T+E  +S 
Sbjct: 226 TTEEGASEEEDEESASEEQTSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSEEEESA 285

Query: 450 ATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSH 509
           +    +EN  + Q   +  S      E    + +E+N        + +     GNE+   
Sbjct: 286 SEEEDEENESKEQTTEEEESASEEEDEESASEREEKN-------ASQEEEEDEGNESKEQ 338

Query: 510 TTDKQNETSEDANSKVEDSSTDTTTPKTEDSNA-----DAAGDDVDSTYKSSSGNSDSNA 564
           TT+++   SE+ +   E+S ++  T + E+  A     +  G+D +S  +S +    ++ 
Sbjct: 339 TTEEEESASEEED---EESVSEEQTSEGEEKGASQEEEEDEGNDQESEVESQASEEQTSE 395

Query: 565 NNGAYKETTNLVQNENPNGNSVQEG---KQDASHEAQLTASDTSSEQKKDESSNAETNTD 621
             GA +E     +NE+    + +E    ++D    ++    + S E+++DE +  E+  +
Sbjct: 396 EEGASEEEDE--ENESEEQTTEEESASEEEDEESASEGEEKNASQEEEEDEGNEQESEVE 453

Query: 622 SVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSN 681
           S  ++   S+      EG++ +  E ++  S + +SEE +EG+S  E+   A +  ++  
Sbjct: 454 SQASEEQTSE--EEEKEGASQEEDEENE--SEEQTSEEEEEGASEEEDEESAFEEQTSEE 509

Query: 682 ENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGS 741
           E + G +  +  + EN    + SE + +A++ ++ E E A +E   + E  + + +++  
Sbjct: 510 EEEKGASQEEEEDEEN---EQESEVESQASEEQTSEEEGASEEGQDASEEEDEDESEEEE 566

Query: 742 SSD 744
           S +
Sbjct: 567 SDE 569



 Score =  174 bits (442), Expect = 7e-42
 Identities = 121/547 (22%), Positives = 255/547 (46%), Gaps = 53/547 (9%)

Query: 97  NLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQD 156
           N D++ + DE     K  E        NGVD+ +  +K E   K       +E S   +D
Sbjct: 71  NSDDICTEDETTVIEKESE--------NGVDKEKPTSKEESGEKTSQEKESEEKSSQEKD 122

Query: 157 LVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKEN---EENKHEAENKEA 213
             + E E S E   +  ++ +  +   EE ++T  ++N    +EN   EE+  +A  ++A
Sbjct: 123 EDKSESEASEEKDVSQEQNSKEEKGASEEDEDTPEEQNSK--EENGSSEEDDEDASEEQA 180

Query: 214 AEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVE 273
           +   +E S+++N  +++++    + + E  +  E +VE    E + T++  +EE   E  
Sbjct: 181 SNEEKEASEEKNTVSEERKGASEEEDEEKDDGHESEVESQASEEQTTEEGASEEEDEESA 240

Query: 274 DKEAGEVKEEK--SQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEE 331
            +E     EEK  SQ+E E+  +++  E++++  +++  E +E  S +E+EE + KE   
Sbjct: 241 SEEQTSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSEEEESASEEEDEENESKEQT- 299

Query: 332 INQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQH 391
                T+ ++   E  +++S  E+EE N ++ E+E++G   +E ++E++    E  +E+ 
Sbjct: 300 -----TEEEESASEEEDEESASEREEKNASQEEEEDEGNESKEQTTEEE----ESASEEE 350

Query: 392 REENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNAT 451
            EE+ + +  S   +        +  ++ E+ D+    ESE+ESQ S  +T+E       
Sbjct: 351 DEESVSEEQTSEGEE--------KGASQEEEEDEGNDQESEVESQASEEQTSE------- 395

Query: 452 TNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTT 511
               E G   +   +N SE+++T E    + +++ +  S+G E   S  +  +E     +
Sbjct: 396 ----EEGASEEEDEENESEEQTTEEESASEEEDEES-ASEGEEKNASQEEEEDEGNEQES 450

Query: 512 DKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKE 571
           + +++ SE+  S+ E+    +     E+ + +   ++         G S+      A++E
Sbjct: 451 EVESQASEEQTSEEEEKEGASQEEDEENESEEQTSEE------EEEGASEEEDEESAFEE 504

Query: 572 TTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSD 631
            T+  + E   G S +E + + + +     S  S EQ  +E   +E   D+ + ++ +  
Sbjct: 505 QTS--EEEEEKGASQEEEEDEENEQESEVESQASEEQTSEEEGASEEGQDASEEEDEDES 562

Query: 632 GSNTNSE 638
               + E
Sbjct: 563 EEEESDE 569



 Score =  174 bits (440), Expect = 1e-41
 Identities = 135/569 (23%), Positives = 262/569 (45%), Gaps = 54/569 (9%)

Query: 165 SSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQE 224
           S    R D   ++  +K    SD+  +++  +++++  EN  + E   + E   EK+ QE
Sbjct: 51  SHSEDRYDDGVDRKWKKREGNSDDICTEDETTVIEKESENGVDKEKPTSKEESGEKTSQE 110

Query: 225 --NEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE--ETKDKENEEIKNEVEDKEAGEV 280
             +EE   +E +E K+E E +E  +V  E++ +E +    +D++  E +N  E+  + E 
Sbjct: 111 KESEEKSSQEKDEDKSESEASEEKDVSQEQNSKEEKGASEEDEDTPEEQNSKEENGSSEE 170

Query: 281 KEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVK 340
            +E + +E    ++KE  E KN V ++  G      S +E+EE  D    E+    ++  
Sbjct: 171 DDEDASEEQASNEEKEASEEKNTVSEERKGA-----SEEEDEEKDDGHESEVESQASE-- 223

Query: 341 DHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDN 400
              E+  E+ + EE++E    E+  EEQ    EE  + ++ ++ EGN ++   E+ A + 
Sbjct: 224 ---EQTTEEGASEEEDE----ESASEEQTSEGEEKGASQEEEEDEGNEQESEVESQASEE 276

Query: 401 ASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQEN-GG 459
            +S  +  + +  +E     EQ  + E++ SE E ++S +E  E    NA+   +E+ G 
Sbjct: 277 QTSEEEESASEEEDEENESKEQTTEEEESASEEEDEESASEREE---KNASQEEEEDEGN 333

Query: 460 ENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSE 519
           E++ QT    E  S  E      +EQ   TS+G E   S  +  +E     ++ +++ SE
Sbjct: 334 ESKEQTTEEEESASEEEDEESVSEEQ---TSEGEEKGASQEEEEDEGNDQESEVESQASE 390

Query: 520 DANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNE 579
           +  S+ E +S +           D   +  + T +  S + + +  + +  E  N  Q E
Sbjct: 391 EQTSEEEGASEE----------EDEENESEEQTTEEESASEEEDEESASEGEEKNASQEE 440

Query: 580 NPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEG 639
             +    +  +Q++  E+Q +   TS E++K+ +S  E        +N + + ++   E 
Sbjct: 441 EED----EGNEQESEVESQASEEQTSEEEEKEGASQEE------DEENESEEQTSEEEEE 490

Query: 640 SANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSV 699
            A++ ++         S EE ++G+S  E   + N+  S             A+E + S 
Sbjct: 491 GASEEEDEESAFEEQTSEEEEEKGASQEEEEDEENEQES--------EVESQASEEQTSE 542

Query: 700 QRKTSENDGEAAQNESVESEKAKDESAHS 728
           +   SE +G+ A  E  E E  ++ES  S
Sbjct: 543 EEGASE-EGQDASEEEDEDESEEEESDES 570



 Score =  161 bits (408), Expect = 6e-38
 Identities = 117/458 (25%), Positives = 222/458 (47%), Gaps = 45/458 (9%)

Query: 80  KEQDEESEHESKTEEQINLDEVNSVDEN----EPEHKPEEEHIKLDDANGVDENEVENKP 135
           +E+DE+      +EE+    E NS +E     E E  PEE++ K  + NG  E + E+  
Sbjct: 119 QEKDEDKSESEASEEKDVSQEQNSKEEKGASEEDEDTPEEQNSK--EENGSSEEDDEDAS 176

Query: 136 EEHIKLDDANGVDEN---SEHSQDLVEHEGEGSSENARTDIES-------------EQHV 179
           EE    ++    +E    SE  +   E E E   +   +++ES             E+  
Sbjct: 177 EEQASNEEKEASEEKNTVSEERKGASEEEDEEKDDGHESEVESQASEEQTTEEGASEEED 236

Query: 180 EKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNE 239
           E+   E   +E +E  +  +E E+  +E E++  ++  EE++ +E E   ++E+EE +++
Sbjct: 237 EESASEEQTSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSEEEESASEEEDEENESK 296

Query: 240 VEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEE 299
            + TE  E     S++E+EE+  +  E+  ++ E+++ G   +E++ +E E   ++E+EE
Sbjct: 297 EQTTEEEE---SASEEEDEESASEREEKNASQEEEEDEGNESKEQTTEEEESASEEEDEE 353

Query: 300 IKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVE-----ENHEQDSKEE 354
             +E +  E GE K     +E +E  D+E+E  +Q   +     E     E+ E +S+E+
Sbjct: 354 SVSEEQTSE-GEEKGASQEEEEDEGNDQESEVESQASEEQTSEEEGASEEEDEENESEEQ 412

Query: 355 -KEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHK----- 408
             EE + +E E EE     EE ++ ++ ++ EGN ++   E+ A +  +S  + K     
Sbjct: 413 TTEEESASEEEDEESASEGEEKNASQEEEEDEGNEQESEVESQASEEQTSEEEEKEGASQ 472

Query: 409 SQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATT--------NIQENGGE 460
            +D  NES  +T + ++   +E E E      +T+E  +    +        N QE+  E
Sbjct: 473 EEDEENESEEQTSEEEEEGASEEEDEESAFEEQTSEEEEEKGASQEEEEDEENEQESEVE 532

Query: 461 NQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDS 498
           +QA  +  SE+   SE G    +E++   S+  E+ +S
Sbjct: 533 SQASEEQTSEEEGASEEGQDASEEEDEDESEEEESDES 570



 Score =  157 bits (398), Expect = 9e-37
 Identities = 127/525 (24%), Positives = 244/525 (46%), Gaps = 43/525 (8%)

Query: 250 VEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEA 309
           V++  ++ E   D    E +  V +KE+    +++     EE+ +K ++E   E E+K +
Sbjct: 61  VDRKWKKREGNSDDICTEDETTVIEKESENGVDKEKPTSKEESGEKTSQE--KESEEKSS 118

Query: 310 GEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENH----EQDSKEE--KEESNGTEA 363
            E  E+KS  E  E KD   E   QN  + K   EE+     EQ+SKEE    E +  +A
Sbjct: 119 QEKDEDKSESEASEEKDVSQE---QNSKEEKGASEEDEDTPEEQNSKEENGSSEEDDEDA 175

Query: 364 EKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHK-SQDIFNESYNKTEQ 422
            +E+    ++EAS EK     E       E+    D   S V+ + S++   E     E+
Sbjct: 176 SEEQASNEEKEASEEKNTVSEERKGASEEEDEEKDDGHESEVESQASEEQTTEEGASEEE 235

Query: 423 VDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQH 482
            +++   E   E ++ G    E  D     N QE+  E+QA  +  SE+    ES  ++ 
Sbjct: 236 DEESASEEQTSEGEEKGASQEEEEDEG---NEQESEVESQASEEQTSEE---EESASEEE 289

Query: 483 QEQNNPTSDGVETVDSSSQNGNETTSHTTDKQN---ETSEDANSKVEDSSTDTTTPKTED 539
            E+N       E  +S+S+  +E ++   +++N   E  ED  ++ ++ +T+     +E+
Sbjct: 290 DEENESKEQTTEEEESASEEEDEESASEREEKNASQEEEEDEGNESKEQTTEEEESASEE 349

Query: 540 SNADAAGDDVDSTYKSSSGNSDSNANNGAYKET-----TNLVQNENPNGNSVQEGKQDAS 594
            + ++  ++  S  +    + +   + G  +E+      +  Q     G S +E +++ S
Sbjct: 350 EDEESVSEEQTSEGEEKGASQEEEEDEGNDQESEVESQASEEQTSEEEGASEEEDEENES 409

Query: 595 HEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSD 654
            E Q T  +++SE++ +ES++        + +  N+       EG+  +++  SQ +   
Sbjct: 410 EE-QTTEEESASEEEDEESAS--------EGEEKNASQEEEEDEGNEQESEVESQASEEQ 460

Query: 655 VSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGE--AAQ 712
            S EE KEG+S  E+  + N++   ++E +   AS + +E E++ + +TSE + E  A+Q
Sbjct: 461 TSEEEEKEGASQEED--EENESEEQTSEEEEEGASEEEDE-ESAFEEQTSEEEEEKGASQ 517

Query: 713 NESVESEKAKDESAHSDEGSNSNTNDQGSS---SDPSITEEVKES 754
            E  + E  ++    S       + ++G+S    D S  E+  ES
Sbjct: 518 EEEEDEENEQESEVESQASEEQTSEEEGASEEGQDASEEEDEDES 562



 Score =  151 bits (382), Expect = 6e-35
 Identities = 130/471 (27%), Positives = 237/471 (49%), Gaps = 64/471 (13%)

Query: 40  TNEKKASYGESAKTGNDVVRLGRKDLNPLVEETTVVDARHKEQDEE--SEHESKTEEQIN 97
           + EK  S  +++K          +D +   E+ +  +    E+D+E  SE ++  EE+  
Sbjct: 131 SEEKDVSQEQNSKEEKGA---SEEDEDTPEEQNSKEENGSSEEDDEDASEEQASNEEKEA 187

Query: 98  LDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIKLDDANGVDENSEHSQDL 157
            +E N+V E E +   EEE  + DD +   E+EVE++  E    ++    +E+ E + + 
Sbjct: 188 SEEKNTVSE-ERKGASEEEDEEKDDGH---ESEVESQASEEQTTEEGASEEEDEESASEE 243

Query: 158 VEHEGE--GSSENARTD--------IESEQHVEKVGEESDNT---ESKENDSLVK--ENE 202
              EGE  G+S+    D        +ES+   E+  EE ++    E +EN+S  +  E E
Sbjct: 244 QTSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSEEEESASEEEDEENESKEQTTEEE 303

Query: 203 ENKHEAENKEAAEVHEEK--SQQENE----ETKDK--ENEEIKNEVEDTEA--------G 246
           E+  E E++E+A   EEK  SQ+E E    E+K++  E EE  +E ED E+        G
Sbjct: 304 ESASEEEDEESASEREEKNASQEEEEDEGNESKEQTTEEEESASEEEDEESVSEEQTSEG 363

Query: 247 EVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVED 306
           E K    ++E +E  D+E+ E++++  +++  E  EE + +E    +D+ENE  +   E+
Sbjct: 364 EEKGASQEEEEDEGNDQES-EVESQASEEQTSE--EEGASEE----EDEENESEEQTTEE 416

Query: 307 KEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKE 366
           + A E ++E+S  E EE K+   EE    G + +  VE    ++   E+EE  G   E++
Sbjct: 417 ESASEEEDEESASEGEE-KNASQEEEEDEGNEQESEVESQASEEQTSEEEEKEGASQEED 475

Query: 367 EQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKN 426
           E+ + +E+ S E++    EG +E+  EE+   +  S   + K         ++ E+ D+ 
Sbjct: 476 EENESEEQTSEEEE----EGASEEEDEESAFEEQTSEEEEEKGA-------SQEEEEDEE 524

Query: 427 EKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSES 477
            + ESE+ESQ S  +T+E   ++     +E    ++ + ++ SE+  + ES
Sbjct: 525 NEQESEVESQASEEQTSEEEGAS-----EEGQDASEEEDEDESEEEESDES 570



 Score =  147 bits (371), Expect = 1e-33
 Identities = 107/501 (21%), Positives = 214/501 (42%), Gaps = 28/501 (5%)

Query: 283 EKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDH 342
           E    +  + K K+ E   +++  ++   V E++S    ++ K    EE  +     K  
Sbjct: 54  EDRYDDGVDRKWKKREGNSDDICTEDETTVIEKESENGVDKEKPTSKEESGE-----KTS 108

Query: 343 VEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNAS 402
            E+  E+ S +EK+E   +E+E  E+  + +E +S+++    E + +   E+N   +N S
Sbjct: 109 QEKESEEKSSQEKDEDK-SESEASEEKDVSQEQNSKEEKGASEEDEDTPEEQNSKEENGS 167

Query: 403 SAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQ 462
           S  D   +D   E  +  E+    EKN    E + +  E +E  D    + ++    E Q
Sbjct: 168 SEED--DEDASEEQASNEEKEASEEKNTVSEERKGASEEEDEEKDDGHESEVESQASEEQ 225

Query: 463 AQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDAN 522
              +  SE+     +  +Q  E     +   E  D  ++  +E  S  +++Q    E++ 
Sbjct: 226 TTEEGASEEEDEESASEEQTSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSEEEESA 285

Query: 523 SKVEDSSTDTTTPKTEDSNADAAGDDVDST----YKSSSGNSDSNANNGAYKETTNLVQN 578
           S+ ED   ++    TE+  + +  +D +S      K++S   + +  N + ++TT     
Sbjct: 286 SEEEDEENESKEQTTEEEESASEEEDEESASEREEKNASQEEEEDEGNESKEQTT----- 340

Query: 579 ENPNGNSVQEGKQDASHEAQLTASD--TSSEQKKDESSNAETNTDSVQNDNVNSDGSNTN 636
           E     S +E ++  S E      +   S E+++DE ++ E+  +S  ++   S+    +
Sbjct: 341 EEEESASEEEDEESVSEEQTSEGEEKGASQEEEEDEGNDQESEVESQASEEQTSEEEGAS 400

Query: 637 SEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENE 696
            E    +  E         S EE +E +S  E      +N S   E D GN      E++
Sbjct: 401 EEEDEENESEEQTTEEESASEEEDEESASEGE-----EKNASQEEEEDEGNEQESEVESQ 455

Query: 697 NSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHI 756
            S ++ + E + E A  E  E  +++++++  +E   S   D+ S+ +   +EE +E   
Sbjct: 456 ASEEQTSEEEEKEGASQEEDEENESEEQTSEEEEEGASEEEDEESAFEEQTSEEEEEK-- 513

Query: 757 DLGTLPESNAESNHRDVSSAE 777
             G   E   +  +   S  E
Sbjct: 514 --GASQEEEEDEENEQESEVE 532



 Score =  135 bits (339), Expect = 6e-30
 Identities = 90/357 (25%), Positives = 172/357 (47%), Gaps = 22/357 (6%)

Query: 70  EETTVVDARHKEQDEESEHESKTEE-------QINLDEVNSVDENEPEHKPEEEHIKLDD 122
           EE T  +   +E+DEES  E +T E       Q   ++  +  E+E E +  EE    ++
Sbjct: 223 EEQTTEEGASEEEDEESASEEQTSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSEEE 282

Query: 123 ANGVDENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKV 182
            +  +E + EN+ +E    ++ +  +E  E S    E E + +S+    D E  +  E+ 
Sbjct: 283 ESASEEEDEENESKEQTTEEEESASEEEDEESAS--EREEKNASQEEEED-EGNESKEQT 339

Query: 183 GEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVED 242
            EE ++   +E++  V E + ++ E +     E  +E + QE+E       E+   E   
Sbjct: 340 TEEEESASEEEDEESVSEEQTSEGEEKGASQEEEEDEGNDQESEVESQASEEQTSEEEGA 399

Query: 243 TEAGEVKVEKSQQ--ENEETKDKENEEIKNEVEDKEAGEVKEEKSQQENE-ETKDKENEE 299
           +E  + + E  +Q  E E   ++E+EE  +E E+K A + +EE    E E E + + +EE
Sbjct: 400 SEEEDEENESEEQTTEEESASEEEDEESASEGEEKNASQEEEEDEGNEQESEVESQASEE 459

Query: 300 IKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESN 359
             +E E+KE    +E++  +  E+T ++E E     G   ++  E   E+ + EE+EE  
Sbjct: 460 QTSEEEEKEGASQEEDEENESEEQTSEEEEE-----GASEEEDEESAFEEQTSEEEEEKG 514

Query: 360 GTEAEKEEQGKIQ----EEASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDI 412
            ++ E+E++   Q    E  +SE+Q  + EG +E+ ++ +   D   S  +   + +
Sbjct: 515 ASQEEEEDEENEQESEVESQASEEQTSEEEGASEEGQDASEEEDEDESEEEESDESV 571



 Score = 72.0 bits (175), Expect = 6e-11
 Identities = 62/276 (22%), Positives = 120/276 (43%), Gaps = 25/276 (9%)

Query: 510 TTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAY 569
           T    N     ++S++       + P     + D   D VD  +K   GNSD        
Sbjct: 22  TVTSSNAIPGRSSSRLRLLERYDSLPSLRSHSEDRYDDGVDRKWKKREGNSDDICT---- 77

Query: 570 KETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVN 629
           ++ T +++ E+ NG  V + K  +  E+      TS E++ +E S+ E + D  +++   
Sbjct: 78  EDETTVIEKESENG--VDKEKPTSKEES---GEKTSQEKESEEKSSQEKDEDKSESEA-- 130

Query: 630 SDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNAS 689
           S+  + + E ++ + K AS+ +      + SKE       SS+  ++  +++E    N  
Sbjct: 131 SEEKDVSQEQNSKEEKGASEEDEDTPEEQNSKE----ENGSSE--EDDEDASEEQASNEE 184

Query: 690 HDANENENSVQRK----TSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDP 745
            +A+E +N+V  +    + E D E       E E    E   ++EG++   +++ +S + 
Sbjct: 185 KEASEEKNTVSEERKGASEEEDEEKDDGHESEVESQASEEQTTEEGASEEEDEESASEEQ 244

Query: 746 SITEEVK----ESHIDLGTLPESNAESNHRDVSSAE 777
           +   E K    E   D G   ES  ES   +  ++E
Sbjct: 245 TSEGEEKGASQEEEEDEGNEQESEVESQASEEQTSE 280


>UniRef100_Q88XB6 Cell surface SD repeat protein [Lactobacillus plantarum]
          Length = 3360

 Score =  177 bits (449), Expect = 1e-42
 Identities = 108/743 (14%), Positives = 334/743 (44%), Gaps = 9/743 (1%)

Query: 41   NEKKASYGESAKTGNDVVRLGRKDLNPLVEETTV---VDARHKEQDEESEHESKTEEQIN 97
            N   +SY E AK         +K  +   ++      + A   E D +S+ +  ++   +
Sbjct: 1508 NSAASSYAEEAKKKASEASEAKKKASSAADDAGYYADLAANVSEDDSDSDSDGDSDSDSD 1567

Query: 98   LDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHIKLDDANGVDENSEHSQD 156
             D  +  D +       +     D D++   +++ ++  +     D  +  D +S+   D
Sbjct: 1568 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1627

Query: 157  LVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEV 216
                    S  ++ +D +S+   +   +   +++S  +     +++ +     + ++   
Sbjct: 1628 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1687

Query: 217  HEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKE 276
             +  S  +++   D +++   +   D+++       S  +++   D +++   +   D +
Sbjct: 1688 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1747

Query: 277  AGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNG 336
            +    +  S  +++   D +++   +   D ++    +  S  +++   D +++  + + 
Sbjct: 1748 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1807

Query: 337  TDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENY 396
            +D     + + + DS  + +  + ++++ +       ++ S+    D + +++   + + 
Sbjct: 1808 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDS 1866

Query: 397  AGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQE 456
              D+ S +      D  ++S   ++    ++ +        S ++++  +DS++ ++  +
Sbjct: 1867 DSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SD 1925

Query: 457  NGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDSSSQNGNETTSHTTDKQN 515
            +  ++ + +D+ S+  S S+S      + ++ + SD     DS S + +++ S +    +
Sbjct: 1926 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1985

Query: 516  ETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNL 575
              S+  +    DS +D+ +    DS++D+  D    +   S  +SDS++++ +  ++ + 
Sbjct: 1986 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2045

Query: 576  VQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDG-SN 634
              +++ + +         S     + SD+ S+   D  S++++++DS  + + +SD  S+
Sbjct: 2046 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2105

Query: 635  TNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANE 694
            +NS+  ++ + ++   + SD  S+   +  S+S++ SD++ +  + +++D+ + S D++ 
Sbjct: 2106 SNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDS 2164

Query: 695  NENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKES 754
            + +S     S++D ++  +   +S+   D  + SD  S+S+++    S   S ++   +S
Sbjct: 2165 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2224

Query: 755  HIDLGTLPESNAESNHRDVSSAE 777
              D  +  +S+++S+    S ++
Sbjct: 2225 DSDSDSDSDSDSDSDSDSDSDSD 2247



 Score =  176 bits (447), Expect = 2e-42
 Identities = 104/699 (14%), Positives = 328/699 (46%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1571 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1630

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1631 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1690

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1750

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1751 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1810

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1811 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1870

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +  GD+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1871 D-SDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1927

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1928 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1986

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 1987 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2046

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2106

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            N+DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2107 NSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2165

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2166 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2224

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2225 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2263



 Score =  175 bits (443), Expect = 5e-42
 Identities = 107/700 (15%), Positives = 331/700 (47%), Gaps = 12/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++G  +++ ++  +   
Sbjct: 1843 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDS 1902

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 1903 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-- 1960

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
             +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1961 -DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2019

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2020 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2079

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + N + DS  + +  + ++++ +       ++ S+
Sbjct: 2080 SDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2139

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2140 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2196

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2197 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2255

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2256 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2315

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2316 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2375

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2376 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2434

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2435 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2493

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2494 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2533



 Score =  175 bits (443), Expect = 5e-42
 Identities = 103/699 (14%), Positives = 329/699 (46%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1785 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1844

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +  G+   +++S  +     
Sbjct: 1845 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDS 1904

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1905 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1964

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1965 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2024

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2025 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2084

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S++      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2085 D-SDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2141

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2142 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2200

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2201 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2260

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2261 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2320

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2321 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2379

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2380 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2438

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2439 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2477



 Score =  174 bits (441), Expect = 9e-42
 Identities = 100/699 (14%), Positives = 322/699 (45%), Gaps = 6/699 (0%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1993 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2052

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  N     
Sbjct: 2053 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDS 2112

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2113 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2172

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2173 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2232

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2233 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2292

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +        S 
Sbjct: 2293 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2351

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2352 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2410

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2411 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2470

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2471 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2530

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2531 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2589

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2590 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2649 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2687



 Score =  174 bits (440), Expect = 1e-41
 Identities = 106/699 (15%), Positives = 333/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1587 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1646

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1647 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1705

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1706 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1764

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1765 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1824

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1825 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1884

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               DG+ +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1885 D-SDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1941

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1942 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2000

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2001 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2060

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD++S+   D  S++++
Sbjct: 2061 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDS 2120

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2121 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2179

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2180 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2238

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2239 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2277



 Score =  174 bits (440), Expect = 1e-41
 Identities = 108/698 (15%), Positives = 334/698 (47%), Gaps = 16/698 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1585 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1644

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1645 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1703

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1704 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1762

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1763 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1822

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1823 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1882

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D +G+++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1883 D-SDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1939

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS 499
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++  SD     DS 
Sbjct: 1940 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSD 1997

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
            S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  +
Sbjct: 1998 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2057

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   + + + +S  +   D+  ++    SD+ S+   D  SN++++
Sbjct: 2058 SDSDSDSDSDSDSDS---DSDSDSDSDSDSDSDSDSDSD---SDSDSDSDSDSDSNSDSD 2111

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  +
Sbjct: 2112 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2170

Query: 680  SNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQ 739
             +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++  
Sbjct: 2171 DSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2229

Query: 740  GSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
              S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2230 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2267



 Score =  174 bits (440), Expect = 1e-41
 Identities = 100/699 (14%), Positives = 321/699 (45%), Gaps = 6/699 (0%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1647 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1706

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1707 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1766

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1767 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1826

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1827 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1886

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            + +   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1887 DGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1946

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +        S 
Sbjct: 1947 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2005

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2006 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2064

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DSN+D+  D    +   S  
Sbjct: 2065 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDS 2124

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2125 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2184

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2185 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2243

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2244 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2302

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2303 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2341



 Score =  174 bits (440), Expect = 1e-41
 Identities = 103/699 (14%), Positives = 327/699 (46%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1684

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1685 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1744

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1745 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1804

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1805 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1864

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1865 DSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1924

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1925 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1981

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1982 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2040

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2041 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2100

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++N+ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2101 DSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2160

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2161 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2219

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2220 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2278

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2279 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2317



 Score =  174 bits (440), Expect = 1e-41
 Identities = 103/699 (14%), Positives = 325/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1601 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1660

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1661 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1719

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1720 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1778

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1779 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1838

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +  G    ++ S+ 
Sbjct: 1839 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDS 1898

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 1899 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 1956

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1957 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2016

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2017 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2076

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2077 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2136

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2137 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2195

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2196 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2254

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2255 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2293



 Score =  174 bits (440), Expect = 1e-41
 Identities = 103/698 (14%), Positives = 326/698 (45%), Gaps = 8/698 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1999 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2058

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   N++S  +     
Sbjct: 2059 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDS 2118

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2119 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2178

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2179 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2238

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2239 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2298

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2299 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2355

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS 499
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++  SD     DS 
Sbjct: 2356 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSD 2413

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
            S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  +
Sbjct: 2414 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2473

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++++
Sbjct: 2474 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2533

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  +
Sbjct: 2534 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 680  SNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQ 739
             +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++  
Sbjct: 2593 DSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2651

Query: 740  GSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
              S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2652 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2689



 Score =  174 bits (440), Expect = 1e-41
 Identities = 104/699 (14%), Positives = 332/699 (46%), Gaps = 14/699 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1583 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1642

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1702

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1703 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1762

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1763 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1822

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1823 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1882

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D +G+++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1883 D-SDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1939

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1940 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1998

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 1999 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2058

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   + + + +S  +   D+  ++    SD+ S+   D +S++++
Sbjct: 2059 DSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSDSDSDSD---SDSDSDSDSDSNSDSDS 2112

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2113 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2171

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2172 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2230

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2231 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2269



 Score =  174 bits (440), Expect = 1e-41
 Identities = 103/699 (14%), Positives = 327/699 (46%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1627 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1686

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1687 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1746

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1747 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1806

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1866

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1867 DSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1926

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1927 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1983

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1984 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2042

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2043 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2102

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDSN+++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2103 DSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2162

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2163 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2221

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2222 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2280

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2281 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2319



 Score =  174 bits (440), Expect = 1e-41
 Identities = 100/699 (14%), Positives = 322/699 (45%), Gaps = 6/699 (0%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1629 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1688

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1689 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1748

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1749 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1808

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1809 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1868

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1869 DSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1928

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +        S 
Sbjct: 1929 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1987

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1988 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2046

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2106

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            NSDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2107 NSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2166

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2167 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2225

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2226 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2284

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2285 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2323



 Score =  173 bits (439), Expect = 2e-41
 Identities = 102/693 (14%), Positives = 322/693 (45%), Gaps = 8/693 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2463 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2522

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2523 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2581

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2582 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2760

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2761 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2818

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2819 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2878

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2879 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2938

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2939 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2998

Query: 619  NTDSVQNDNVNSDG-SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            ++DS  + + +SD  S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2999 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3058

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 3059 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3117

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNH 770
                S   S ++   +S  D  +  +S+++SN+
Sbjct: 3118 SDSDSDSDSDSDSDSDSDADSDSDSDSDSDSNN 3150



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1987 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2046

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2105

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             N ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2106 SNSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2164

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2165 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2224

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2225 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2284

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2285 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2341

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2342 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2400

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2401 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2460

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2461 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2520

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2521 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2579

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2580 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2638

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2639 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2677



 Score =  173 bits (438), Expect = 2e-41
 Identities = 98/699 (14%), Positives = 314/699 (44%), Gaps = 4/699 (0%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1773 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1832

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1833 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDS 1892

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1893 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1952

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1953 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2012

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2013 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2072

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
                   ++     ++ +  ++ S  D  S    N   +     D +  ++S+ +S    
Sbjct: 2073 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDS 2132

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2133 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2192

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2193 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2252

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2253 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2312

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2313 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2371

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2372 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2430

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2431 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2469



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2037 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2096

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D NS+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2097 DSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2156

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2157 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2215

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2216 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2275

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2276 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2335

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2336 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2392

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2393 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2451

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2452 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2511

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2512 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2571

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2572 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2630

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2631 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2689

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2690 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2729



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1919 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1978

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1979 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2037

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2038 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2096

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   N   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2097 DSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2156

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2157 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2216

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2217 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2273

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2274 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2332

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2333 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2392

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2393 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2453 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2511

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2512 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2570

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2571 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2609



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2019 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2078

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  N+ +D +S+   +   + +SD+    ++DS  
Sbjct: 2079 DSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2138

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2139 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2197

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2198 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2257

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2258 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2317

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2318 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2374

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2375 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2433

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2434 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2493

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2494 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2553

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2554 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2613 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2671

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2672 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2711



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1951 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2010

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2011 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2069

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   N   D+++       S  +++ 
Sbjct: 2070 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 2128

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2129 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2188

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2189 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2248

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2249 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2305

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2306 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2364

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2365 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2424

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2425 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2484

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2485 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2543

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2544 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2641



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D+N   +++ ++  +   
Sbjct: 2063 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDS 2122

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2123 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2182

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2183 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2241

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2242 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2301

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2302 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2361

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2362 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2418

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2419 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2477

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2478 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2537

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2538 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2597

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2598 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2657 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2715

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2716 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2755



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D N       +     D D++   +++ ++  +   
Sbjct: 2081 DSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2140

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2141 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2200

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2201 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2259

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2260 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2319

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2320 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2379

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2380 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2436

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2437 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2495

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2496 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2555

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2556 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2615

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2616 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2674

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2675 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2733

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2734 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2773



 Score =  173 bits (438), Expect = 2e-41
 Identities = 106/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   N D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2091 DSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2150

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2151 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2210

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2211 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2269

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2270 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2329

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2330 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2389

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2390 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2446

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2447 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2505

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2506 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2565

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2566 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2625

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2626 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2684

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2685 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2743

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2744 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2783



 Score =  172 bits (437), Expect = 3e-41
 Identities = 103/700 (14%), Positives = 325/700 (45%), Gaps = 8/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2487 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2546

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2547 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2605

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2606 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2665 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2724

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2725 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2784

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2785 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2842

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2843 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2902

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2903 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2962

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2963 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3022

Query: 619  NTDSVQNDNVNSDG-SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            ++DS  + + +SD  S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 3023 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3082

Query: 678  -SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNT 736
             S+S+ + + ++  D++ + +S     S++D ++  +   +S+   D  + SD  S+S++
Sbjct: 3083 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDS 3142

Query: 737  NDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
            +    S++ S ++ + +S  + GT  ++ + S     SS+
Sbjct: 3143 DSDSDSNNDSDSDTITDSDSNDGTNSDNGSNSGSDGSSSS 3182



 Score =  172 bits (437), Expect = 3e-41
 Identities = 106/699 (15%), Positives = 330/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1765 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1824

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1825 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1883

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + +   ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1884 SDSDGDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1942

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1943 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2002

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2003 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2062

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D N  ++S+ +S  S 
Sbjct: 2063 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSNSDSDSDSDSD-SD 2119

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2120 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2178

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2179 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2238

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2239 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2298

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2299 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2357

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2358 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2416

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2417 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2455



 Score =  172 bits (437), Expect = 3e-41
 Identities = 103/699 (14%), Positives = 323/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1705 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1764

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1765 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1823

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1824 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1882

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D + +   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1883 DSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1942

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1943 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2002

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2003 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2060

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + N+ + SD     DS
Sbjct: 2061 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDS 2120

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2121 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2180

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2181 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2240

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2241 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2299

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2300 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2358

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2359 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2397



 Score =  172 bits (437), Expect = 3e-41
 Identities = 106/699 (15%), Positives = 329/699 (46%), Gaps = 12/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1981 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2040

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2041 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDS--- 2096

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     N ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2097 DSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2156

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2157 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2216

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2217 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2276

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2277 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2333

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2334 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2392

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2393 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2453 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2512

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2513 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2571

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2572 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2630

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2631 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2669



 Score =  172 bits (437), Expect = 3e-41
 Identities = 103/699 (14%), Positives = 325/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1737 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1796

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1855

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D + +   +   D+++       S  +++ 
Sbjct: 1856 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDS 1914

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1915 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1974

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1975 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2034

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +        S 
Sbjct: 2035 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2093

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ +N  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2094 SDSDSDSDSDSDSN-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2152

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2153 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2212

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2213 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2272

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2273 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2331

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2332 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2390

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2391 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2429



 Score =  172 bits (437), Expect = 3e-41
 Identities = 106/699 (15%), Positives = 331/699 (47%), Gaps = 12/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1889 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1948

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1949 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSD 2005

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2006 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2064

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   N   D ++    +  S  
Sbjct: 2065 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDS 2124

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2125 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2184

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2185 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2241

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2242 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2300

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2301 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2360

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2361 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2420

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2421 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2479

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2480 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2538

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2539 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2577



 Score =  172 bits (437), Expect = 3e-41
 Identities = 103/699 (14%), Positives = 325/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1761 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1820

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1821 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1879

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  + ++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1880 SDSDSDSDGDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1938

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1939 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1998

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1999 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2058

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ N        S 
Sbjct: 2059 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSD 2117

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2118 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2176

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2177 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2236

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2237 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2296

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2297 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2355

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2356 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2414

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2415 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2453



 Score =  172 bits (437), Expect = 3e-41
 Identities = 106/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1565 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1624

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1683

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1684 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1742

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1743 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1802

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1803 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1862

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1863 D-SDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1919

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1920 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1978

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 1979 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2038

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2039 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2098

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + N +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2099 DSDSDSDSNSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2157

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2158 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2216

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2217 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2255



 Score =  172 bits (437), Expect = 3e-41
 Identities = 105/699 (15%), Positives = 335/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIK 140
            + D +S+ +S ++   + D  NS  +++ +   + +     D++   +++ ++  +    
Sbjct: 2087 DSDSDSDSDSDSDSDSDSDS-NSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2145

Query: 141  LDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLVK 199
             D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS   
Sbjct: 2146 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2205

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2206 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2264

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2265 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2324

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2325 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2384

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2385 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2441

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2442 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2500

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2501 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2560

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2561 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2621 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2679

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2680 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2738

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2739 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2777



 Score =  172 bits (436), Expect = 3e-41
 Identities = 106/699 (15%), Positives = 329/699 (46%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1985 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2044

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2045 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDS-DS 2102

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ N     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2103 DSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2162

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2163 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2222

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2223 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2282

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2283 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2339

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2340 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2398

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2399 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2458

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2459 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2518

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2519 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2577

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2578 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2636

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2637 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2675



 Score =  172 bits (436), Expect = 3e-41
 Identities = 103/699 (14%), Positives = 326/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1741 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1800

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1801 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1859

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1860 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1918

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1919 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1978

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1979 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2038

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +        S 
Sbjct: 2039 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2097

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DSN+ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2098 SDSDSDSDSNSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2156

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2157 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2216

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2217 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2276

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2277 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2335

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2336 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2394

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2395 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2433



 Score =  172 bits (436), Expect = 3e-41
 Identities = 103/699 (14%), Positives = 326/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1747 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1806

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1865

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1866 SDSDSDSDSDSDSDSD-SDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1924

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1925 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1984

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1985 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2044

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +        S 
Sbjct: 2045 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2103

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            +++N  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2104 SDSNSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2162

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2163 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2222

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2223 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2282

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2283 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2341

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2342 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2400

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2401 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2439



 Score =  172 bits (436), Expect = 3e-41
 Identities = 102/699 (14%), Positives = 327/699 (46%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1633 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1692

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 1693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1752

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1753 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1812

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1813 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1872

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  +   +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1873 DSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1932

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1933 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1989

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1990 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2048

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S+ 
Sbjct: 2049 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNS 2108

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2109 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2168

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2169 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2227

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2228 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2286

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2287 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2325



 Score =  172 bits (436), Expect = 3e-41
 Identities = 106/701 (15%), Positives = 331/701 (47%), Gaps = 10/701 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1799 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1858

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  +  +D +S+   +   + +SD+    ++DS  
Sbjct: 1859 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1918

Query: 199  KENEENKHEAENKEAAEVHEEK-SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQEN 257
              + ++  ++++   ++   +  S  +++   D +++   +   D+++       S  ++
Sbjct: 1919 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1978

Query: 258  EETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKS 317
            +   D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S
Sbjct: 1979 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2038

Query: 318  RQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASS 377
              +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S
Sbjct: 2039 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2098

Query: 378  EKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQK 437
            +    D + N++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  
Sbjct: 2099 DSD-SDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD- 2155

Query: 438  SGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETV 496
            S ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     
Sbjct: 2156 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2214

Query: 497  DSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSS 556
            DS S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S
Sbjct: 2215 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2274

Query: 557  SGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNA 616
              +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++
Sbjct: 2275 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2334

Query: 617  ETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQN 676
            ++++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +
Sbjct: 2335 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2393

Query: 677  GSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNT 736
              + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S++
Sbjct: 2394 SDSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 737  NDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
            +    S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2453 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2493



 Score =  172 bits (436), Expect = 3e-41
 Identities = 103/699 (14%), Positives = 324/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1734

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1735 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1793

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1794 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1852

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1853 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDS 1912

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1913 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1972

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 1973 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2030

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2031 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2090

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    N  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2091 DSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2150

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2151 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2210

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2211 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2269

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2270 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2328

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2329 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2367



 Score =  172 bits (435), Expect = 4e-41
 Identities = 105/700 (15%), Positives = 333/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       + +   D D++   +++ ++  +   
Sbjct: 2071 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDS 2130

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2131 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2190

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2191 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2249

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2250 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2309

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2310 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2369

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2370 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2426

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2427 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2485

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2486 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2545

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2546 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2605

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2606 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2665 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2723

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2724 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2763



 Score =  172 bits (435), Expect = 4e-41
 Identities = 104/699 (14%), Positives = 325/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1771 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1830

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1831 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDGD 1889

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1890 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1948

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1949 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2008

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2009 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2068

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
                   ++     ++ +  ++ S  D  S    +   N     D +  ++S+ +S  S 
Sbjct: 2069 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSD-SD 2127

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2128 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2186

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2187 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2246

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2247 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2306

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2307 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2365

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2366 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2424

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2425 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2463



 Score =  172 bits (435), Expect = 4e-41
 Identities = 107/699 (15%), Positives = 334/699 (47%), Gaps = 14/699 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1611 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1670

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1671 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1729

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1730 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1788

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1789 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1848

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +    ++++ +       ++ S+ 
Sbjct: 1849 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDS 1908

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1909 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1965

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1966 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2024

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2025 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2084

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   + + + NS  +   D+  ++  + SD+ S+   D  S++++
Sbjct: 2085 DSDSDSDSDSDSDSDS---DSDSDSNSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDS 2140

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2141 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2199

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2200 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2258

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2259 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2297



 Score =  172 bits (435), Expect = 4e-41
 Identities = 103/701 (14%), Positives = 324/701 (45%), Gaps = 8/701 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2451 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2510

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2511 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2569

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2570 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2628

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2629 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2688

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2689 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2748

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2749 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2806

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2866

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2867 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2926

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2927 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2986

Query: 619  NTDSVQNDNVNSDG-SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            ++DS  + + +SD  S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2987 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3046

Query: 678  -SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNT 736
             S+S+ + + ++  D++ + +S     S++D ++  +   +S+   D  + SD  S+S++
Sbjct: 3047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3106

Query: 737  NDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
            +    S   S ++   +S  D  +  +S+A+S+    S ++
Sbjct: 3107 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDSDSDSD 3147



 Score =  172 bits (435), Expect = 4e-41
 Identities = 103/701 (14%), Positives = 324/701 (45%), Gaps = 8/701 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2441 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2500

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2501 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2559

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2560 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2618

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2619 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2678

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2679 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2738

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2739 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2796

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2856

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2857 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2916

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2917 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2976

Query: 619  NTDSVQNDNVNSDG-SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            ++DS  + + +SD  S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2977 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3036

Query: 678  -SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNT 736
             S+S+ + + ++  D++ + +S     S++D ++  +   +S+   D  + SD  S+S++
Sbjct: 3037 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3096

Query: 737  NDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
            +    S   S ++   +S  D  +  +S+++S+    S A+
Sbjct: 3097 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAD 3137



 Score =  172 bits (435), Expect = 4e-41
 Identities = 105/700 (15%), Positives = 333/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2027 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2086

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D   +    S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2087 DSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2146

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2147 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2205

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2206 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2265

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2266 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2325

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2326 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2382

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2383 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2441

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2442 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2501

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2502 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2561

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2562 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2621 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2679

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2680 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2719



 Score =  172 bits (435), Expect = 4e-41
 Identities = 105/700 (15%), Positives = 333/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2009 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2068

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+ + +   + +SD+    ++DS  
Sbjct: 2069 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 2128

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2129 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2187

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2188 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2247

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2248 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2307

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2308 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2364

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2365 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2423

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2424 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2483

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2484 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2543

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2544 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2603 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2661

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2662 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2701



 Score =  172 bits (435), Expect = 4e-41
 Identities = 105/700 (15%), Positives = 333/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  + + 
Sbjct: 2049 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNS 2108

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2109 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2168

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2169 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2227

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2228 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2287

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2288 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2347

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2348 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2404

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2405 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2463

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2464 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2523

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2524 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2583

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2584 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2643 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2701

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2702 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2741



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2053 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDS 2112

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2113 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2172

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2173 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2231

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2232 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2291

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2292 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2351

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2352 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2408

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2409 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2467

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2468 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2527

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2528 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2587

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2588 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2646

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2647 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2705

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2706 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2745



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1969 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2028

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2029 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2087

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2088 SDSDSDSDSDSDSDSD-SDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2146

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2147 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2206

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2207 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2266

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2267 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2323

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2324 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2382

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2383 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2442

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2443 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2502

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2503 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2561

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2562 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2621 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2659



 Score =  171 bits (434), Expect = 6e-41
 Identities = 107/699 (15%), Positives = 335/699 (47%), Gaps = 14/699 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1617 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1676

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1677 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1735

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1736 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1794

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1854

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1855 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDS 1914

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1915 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1971

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1972 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2030

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2031 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2090

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   N + + +S  +   D+  ++  + SD+ S+   D  S++++
Sbjct: 2091 DSDSDSDSDSDSDSDS---NSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDS 2146

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2147 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2205

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2206 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2264

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2265 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2303



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 332/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1971 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2030

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2031 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2089

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++ + + S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2090 SDSDSDSDSDSDSDSDSNSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2148

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2149 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2208

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2209 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2268

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2269 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2325

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2326 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2384

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2385 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2444

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2445 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2504

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2505 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2563

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2564 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2622

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2623 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2661



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1905 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1964

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1965 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2023

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2024 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2082

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2083 DSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2142

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2143 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2202

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2203 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2259

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2260 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2318

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2319 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2378

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2379 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2438

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2439 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2497

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2498 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2556

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2557 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2595



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2041 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2100

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2101 DSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2160

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2161 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2219

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2220 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2279

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2280 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2339

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2340 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2396

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2397 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2455

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2456 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2515

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2516 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2575

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2576 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2634

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2635 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2693

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2694 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2733



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/700 (15%), Positives = 329/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1667 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1726

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1727 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1785

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1786 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1844

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1845 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDS 1904

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1905 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1964

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 1965 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2022

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2023 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2082

Query: 499  SSQNGNETTSHT-TDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
             S + +++ S + +D  +++  D+NS   DS +D+ +    DS++D+  D    +   S 
Sbjct: 2083 DSDSDSDSDSDSDSDSDSDSDSDSNSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2141

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2142 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2201

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2202 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2260

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2261 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2319

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2320 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2359



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2097 DSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2156

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 2157 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2216

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2217 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2275

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2276 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2335

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2336 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2395

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2396 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2452

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2453 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2511

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2512 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2571

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2572 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2631

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2632 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2690

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2691 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2749

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2750 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2789



 Score =  171 bits (434), Expect = 6e-41
 Identities = 104/700 (14%), Positives = 336/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLD-EVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D + +S  +++ +   + +     D++   +++ ++  +   
Sbjct: 1869 DSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1928

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 1929 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1988

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1989 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2047

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2048 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSN 2107

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2108 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2167

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2168 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2224

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2225 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2283

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2284 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2343

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2344 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2403

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2404 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2463 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2521

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2522 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2561



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1937 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1996

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1997 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2055

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2056 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDS 2114

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2115 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2174

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2175 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2234

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2235 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2291

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2292 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2350

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2351 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2410

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2411 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2470

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2471 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2529

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2530 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2588

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2589 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2627



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1911 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1970

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1971 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2029

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2030 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2088

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2089 DSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2148

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2149 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2208

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2209 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2265

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2266 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2324

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2325 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2384

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2385 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2444

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2445 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2503

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2504 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2562

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2563 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2601



 Score =  171 bits (434), Expect = 6e-41
 Identities = 100/698 (14%), Positives = 324/698 (46%), Gaps = 8/698 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1687 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1746

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1747 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1805

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1806 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1864

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1865 DSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1924

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1925 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1984

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 1985 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2042

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS 499
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ +    ++   S
Sbjct: 2043 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2102

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
              + N  +   +D  +++  D++S   DS +D+ +    DS++D+  D    +   S  +
Sbjct: 2103 DSDSNSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2161

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++++
Sbjct: 2162 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2221

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  +
Sbjct: 2222 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2280

Query: 680  SNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQ 739
             +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++  
Sbjct: 2281 DSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2339

Query: 740  GSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
              S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2340 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2377



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1897 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1956

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1957 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2015

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2016 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2074

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2075 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDS 2134

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2135 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2194

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2195 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2251

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2252 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2310

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2311 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2370

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2371 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2430

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2431 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2489

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2490 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2548

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2549 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2587



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1983 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2042

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2043 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2101

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2102 SDSDSNSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2160

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2161 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2220

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2221 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2280

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2281 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2337

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2338 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2396

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2397 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2456

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2457 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2516

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2517 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2575

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2576 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2634

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2635 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2673



 Score =  171 bits (434), Expect = 6e-41
 Identities = 107/699 (15%), Positives = 335/699 (47%), Gaps = 14/699 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1615 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1674

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1733

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1734 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1792

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1793 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1852

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1853 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDS 1912

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1913 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1969

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1970 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2028

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2029 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2088

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   + N + +S  +   D+  ++  + SD+ S+   D  S++++
Sbjct: 2089 DSDSDSDSDSDSDSDS---DSNSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDS 2144

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2145 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2203

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2204 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2262

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2263 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2301



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1929 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1988

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1989 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2047

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2048 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2106

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2107 NSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2166

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2167 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2226

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2227 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2283

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2284 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2342

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2343 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2402

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2403 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2463 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2521

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2522 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2580

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2581 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2619



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1989 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2048

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2049 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSN 2107

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2108 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2166

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2167 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2226

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2227 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2286

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2287 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2343

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2344 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2402

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2403 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2463 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2522

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2523 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2581

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2582 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2679



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/702 (14%), Positives = 333/702 (46%), Gaps = 10/702 (1%)

Query: 79   HKEQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEE 137
            + + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  + 
Sbjct: 2107 NSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2166

Query: 138  HIKLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDS 196
                D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS
Sbjct: 2167 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2226

Query: 197  LVKENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQE 256
                + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +
Sbjct: 2227 DSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2285

Query: 257  NEETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEK 316
            ++   D +++   +   D ++    +  S  +++   D +++   +   D ++    +  
Sbjct: 2286 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2345

Query: 317  SRQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEAS 376
            S  +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ 
Sbjct: 2346 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2405

Query: 377  SEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQ 436
            S+    D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S 
Sbjct: 2406 SDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD 2463

Query: 437  KSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVET 495
             S ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD    
Sbjct: 2464 -SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2521

Query: 496  VDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKS 555
             DS S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   
Sbjct: 2522 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2581

Query: 556  SSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSN 615
            S  +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+
Sbjct: 2582 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2641

Query: 616  AETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQ 675
            +++++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ 
Sbjct: 2642 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 676  NGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSN 735
            +  + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+
Sbjct: 2701 DSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2759

Query: 736  TNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
            ++    S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2760 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2801



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1961 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2020

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2021 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2079

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2080 SDSDSDSDSDSDSDSD-SDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2138

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2139 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2198

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2199 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2258

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2259 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2315

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2316 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2374

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2375 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2434

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2435 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2494

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2495 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2553

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2554 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2613 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2651



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1943 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2002

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2003 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2061

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2062 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDS 2120

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2121 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2180

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2181 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2240

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2241 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2297

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2298 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2356

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2357 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2416

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2417 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2476

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2477 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2535

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2536 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2594

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2595 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2633



 Score =  171 bits (434), Expect = 6e-41
 Identities = 106/698 (15%), Positives = 327/698 (46%), Gaps = 12/698 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIK 140
            + D +S+ +S ++   + D  +  D +       +     D  +  D +   +   +   
Sbjct: 1823 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1882

Query: 141  LDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKE 200
              D++G D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   +
Sbjct: 1883 DSDSDG-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDS---D 1937

Query: 201  NEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEET 260
            ++ +     + ++    +  S  +++   D +++   +   D+++       S  +++  
Sbjct: 1938 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1997

Query: 261  KDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQE 320
             D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  +
Sbjct: 1998 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2057

Query: 321  NEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQ 380
            ++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+  
Sbjct: 2058 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSD 2117

Query: 381  VQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGT 440
              D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S +
Sbjct: 2118 -SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SDS 2174

Query: 441  ETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDSS 499
            +++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS 
Sbjct: 2175 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2233

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
            S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  +
Sbjct: 2234 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2293

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++++
Sbjct: 2294 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2353

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  +
Sbjct: 2354 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2412

Query: 680  SNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQ 739
             +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++  
Sbjct: 2413 DSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2471

Query: 740  GSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
              S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2472 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2509



 Score =  171 bits (434), Expect = 6e-41
 Identities = 103/698 (14%), Positives = 331/698 (46%), Gaps = 10/698 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1750

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1751 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1809

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1810 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1868

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1869 DSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1928

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1929 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1988

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1989 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2045

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS 499
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ +    ++   S
Sbjct: 2046 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2104

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
              N +  +   +D  +++  D++S   DS +D+ +    DS++D+  D    +   S  +
Sbjct: 2105 DSNSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2163

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++++
Sbjct: 2164 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2223

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  +
Sbjct: 2224 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2282

Query: 680  SNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQ 739
             +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++  
Sbjct: 2283 DSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2341

Query: 740  GSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
              S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2342 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2379



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1991 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2050

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2051 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSNSD 2109

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2110 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2168

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2169 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2228

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2229 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2288

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2289 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2345

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2346 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2404

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2405 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2464

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2465 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2524

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2525 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2583

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2584 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2681



 Score =  171 bits (434), Expect = 6e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2005 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2064

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2065 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-NSDSDSDSDSDSDSDSD 2123

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2124 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2182

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2183 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2242

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2243 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2302

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2303 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2359

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2360 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2418

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2419 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2478

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2479 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2538

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2539 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2597

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2598 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2657 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2695



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2189 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2248

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2249 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2307

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2308 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2366

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2367 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2426

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2427 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2486

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2487 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2543

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2544 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2662

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2663 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2722

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2723 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2781

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2782 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2840

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2841 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2879



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2137 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2196

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2197 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2255

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2256 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2314

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2315 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2374

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2375 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2434

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2435 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2491

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2492 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2550

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2551 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2610

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2611 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2670

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2671 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2729

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2730 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2788

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2789 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2827



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2261 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2320

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2321 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2379

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2380 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2438

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2439 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2498

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2499 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2558

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2559 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2615

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2616 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2674

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2734

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2735 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2794

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2795 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2853

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2854 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2912

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2913 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2951



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2129 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2188

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2189 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2247

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2248 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2306

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2307 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2366

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2367 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2426

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2427 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2483

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2484 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2542

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2543 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2662

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2663 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2721

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2722 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2780

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2781 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2819



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2165 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2224

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2225 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2283

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2284 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2342

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2343 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2402

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2403 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2463 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2519

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2520 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2578

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2579 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2638

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2639 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2698

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2699 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2757

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2758 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2816

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2817 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2855



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2307 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2366

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2367 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2425

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2426 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2484

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2485 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2544

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2545 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2604

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2605 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2661

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2662 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2720

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2721 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2780

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2781 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2840

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2841 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2899

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2900 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2958

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2959 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2997



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2425 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2484

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2485 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2543

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2544 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2662

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2663 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2722

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2723 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2779

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2780 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2838

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2839 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2898

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2899 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2958

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2959 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3017

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3018 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3076

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3077 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3115



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2373 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2432

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2433 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2491

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2492 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2550

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2551 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2610

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2611 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2670

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2671 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2727

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2728 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2786

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2787 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2846

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2847 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2906

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2907 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2965

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2966 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3024

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3025 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3063



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2141 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2200

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2201 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2259

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2260 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2318

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2319 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2378

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2379 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2438

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2439 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2495

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2496 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2554

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2555 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2614

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2615 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2674

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2675 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2733

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2734 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2792

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2793 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2831



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2393 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2453 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2511

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2512 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2570

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2571 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2630

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2631 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2690

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2691 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2747

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2748 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2806

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2866

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2867 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2926

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2927 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2985

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2986 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3044

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3045 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3083



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 12/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2106

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2107 NSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSD 2163

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2164 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2222

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2223 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2282

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2283 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2342

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2343 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2399

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2400 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2458

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2459 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2518

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2519 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2578

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2579 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2637

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2638 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2696

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2697 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2735



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2163 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2222

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2223 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2281

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2282 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2340

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2341 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2400

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2401 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2460

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2461 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2517

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2518 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2576

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2577 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2636

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2637 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2696

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2697 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2755

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2756 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2814

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2815 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2853



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2199 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2258

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2259 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2317

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2318 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2376

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2377 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2436

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2437 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2496

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2497 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2553

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2554 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2613 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2672

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2673 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2732

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2733 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2791

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2792 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2850

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2851 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2889



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2275 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2334

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2335 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2393

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2394 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2453 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2512

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2513 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2572

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2573 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2629

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2630 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2688

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2689 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2748

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2749 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2808

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2809 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2867

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2868 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2926

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2927 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2965



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2217 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2276

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2277 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2335

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2336 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2394

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2395 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2454

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2455 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2514

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2515 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2571

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2572 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2630

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2631 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2690

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2750

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2751 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2809

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2810 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2868

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2869 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2907



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2405 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2464

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2465 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2523

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2524 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2582

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2583 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2702

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2703 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2759

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2760 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2818

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2819 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2878

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2879 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2938

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2939 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2997

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2998 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3056

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3057 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3095



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2229 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2288

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2289 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2347

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2348 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2406

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2407 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2466

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2467 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2526

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2527 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2583

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2584 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2702

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2703 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2762

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2763 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2821

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2822 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2880

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2881 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2919



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2185 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2244

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2245 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2303

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2304 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2362

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2363 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2422

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2423 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2482

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2483 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2539

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2540 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2598

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2599 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2658

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2718

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2719 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2777

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2778 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2836

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2837 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2875



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2305 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2364

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2365 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2423

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2424 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2482

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2483 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2542

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2543 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2603 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2659

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2660 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2718

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2719 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2778

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2779 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2838

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2839 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2897

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2898 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2956

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2957 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2995



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2361 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2420

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2421 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2479

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2480 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2538

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2539 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2598

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2599 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2658

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2659 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2715

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2716 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2774

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2775 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2834

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2835 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2894

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2895 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2953

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2954 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3012

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3013 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3051



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2133 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2192

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2193 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2251

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2252 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2310

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2311 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2370

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2371 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2430

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2431 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2487

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2488 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2546

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2547 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2606

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2607 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2666

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2667 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2725

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2726 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2784

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2785 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2823



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2339 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2398

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2399 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2457

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2458 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2516

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2517 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2576

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2577 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2636

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2637 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2693

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2694 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2752

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2753 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2812

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2813 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2872

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2873 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2931

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2932 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2990

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2991 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3029



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2335 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2394

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2395 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2453

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2454 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2512

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2513 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2572

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2573 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2632

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2633 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2689

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2690 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2748

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2749 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2808

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2809 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2868

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2869 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2927

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2928 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2986

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2987 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3025



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2287 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2346

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2347 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2405

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2406 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2464

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2465 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2524

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2525 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2584

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2585 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2641

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2642 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2760

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2761 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2820

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2821 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2879

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2880 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2938

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2939 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2977



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2413 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2472

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2473 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2531

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2532 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2590

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2591 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2650

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2651 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2710

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2711 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2767

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2768 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2826

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2827 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2886

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2887 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2946

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2947 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3005

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3006 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3064

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3065 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3103



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1935 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1994

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1995 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2053

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2054 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDS 2112

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2113 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2172

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2173 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2232

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2233 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2289

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2290 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2348

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2349 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2408

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2409 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2468

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2469 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2527

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2528 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2586

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2587 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2625



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2181 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2240

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2241 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2299

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2300 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2358

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2359 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2418

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2419 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2478

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2479 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2535

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2536 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2594

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2595 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2654

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2655 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2714

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2715 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2773

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2774 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2832

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2833 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2871



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2209 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2268

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2269 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2327

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2328 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2386

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2387 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2446

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2447 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2506

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2507 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2563

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2564 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2622

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2623 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2682

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2683 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2742

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2743 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2801

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2802 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2860

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2861 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2899



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2233 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2292

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2293 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2351

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2352 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2410

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2411 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2470

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2471 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2530

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2531 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2587

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2588 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2646

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2647 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2706

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2707 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2766

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2767 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2825

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2826 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2884

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2885 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2923



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2355 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2414

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2415 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2473

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2474 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2532

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2533 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2593 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2652

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2653 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2709

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2710 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2768

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2769 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2828

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2829 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2888

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2889 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2947

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2948 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3006

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3007 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3045



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2193 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2252

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2253 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2311

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2312 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2370

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2371 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2430

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2431 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2490

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2491 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2547

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2548 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2606

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2607 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2666

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2667 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2726

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2727 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2785

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2786 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2844

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2845 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2883



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2247 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2306

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2307 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2365

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2366 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2424

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2425 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2484

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2485 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2544

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2545 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2601

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2602 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2660

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2661 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2720

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2721 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2780

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2781 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2839

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2840 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2898

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2899 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2937



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2225 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2284

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2285 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2343

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2344 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2402

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2403 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2463 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2522

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2523 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2579

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2580 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2638

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2639 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2698

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2699 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2758

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2759 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2817

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2818 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2876

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2877 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2915



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2365 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2424

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2425 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2483

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2484 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2542

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2543 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2602

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2662

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2663 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2719

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2720 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2778

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2779 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2838

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2839 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2898

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2899 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2957

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2958 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3016

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3017 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3055



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2253 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2312

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2313 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2371

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2372 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2430

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2431 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2490

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2491 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2550

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2551 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2607

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2608 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2666

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2667 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2726

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2727 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2786

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2787 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2845

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2846 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2904

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2905 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2943



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2125 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2184

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2185 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2243

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2244 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2302

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2303 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2362

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2363 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2422

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2423 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2479

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2480 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2538

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2539 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2598

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2599 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2658

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2659 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2717

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2718 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2776

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2777 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2815



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2269 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2328

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2329 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2387

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2388 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2446

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2447 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2506

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2507 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2566

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2567 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2623

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2624 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2682

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2683 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2742

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2743 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2802

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2803 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2861

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2862 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2920

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2921 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2959



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2303 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2362

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2363 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2421

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2422 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2480

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2481 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2540

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2541 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2600

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2601 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2657

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2658 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2716

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2717 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2776

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2777 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2836

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2837 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2895

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2896 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2954

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2955 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2993



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2191 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2250

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2251 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2309

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2310 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2368

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2369 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2428

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2429 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2488

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2489 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2545

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2546 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2604

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2605 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2665 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2724

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2725 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2783

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2784 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2842

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2843 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2881



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2123 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2182

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2183 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2241

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2242 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2300

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2301 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2360

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2361 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2420

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2421 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2477

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2478 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2536

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2537 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2596

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2597 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2657 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2715

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2716 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2774

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2775 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2813



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1909 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1968

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1969 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2027

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2028 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2086

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2087 DSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2146

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2147 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2206

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2207 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2263

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2264 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2322

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2323 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2382

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2383 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2442

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2443 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2501

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2502 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2560

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2561 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2599



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2409 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2468

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2469 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2527

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2528 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2586

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2587 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2646

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2647 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2706

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2707 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2763

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2764 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2822

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2823 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2882

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2883 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2942

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2943 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3001

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3002 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3060

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3061 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3099



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2331 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2390

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2391 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2449

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2450 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2508

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2509 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2568

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2569 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2628

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2629 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2685

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2686 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2744

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2745 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2804

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2805 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2864

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2865 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2923

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2924 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2982

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2983 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3021



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2121 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2180

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2181 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2239

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2240 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2298

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2299 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2358

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2359 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2418

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2419 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2475

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2476 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2534

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2535 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2594

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2595 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2654

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2655 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2713

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2714 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2772

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2773 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2811



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2421 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2480

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2481 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2539

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2540 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2598

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2599 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2658

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2718

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2719 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2775

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2776 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2834

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2835 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2894

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2895 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2954

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2955 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3013

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3014 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3072

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3073 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3111



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2351 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2410

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2411 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2469

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2470 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2528

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2529 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2588

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2589 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2649 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2705

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2706 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2764

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2765 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2824

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2825 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2884

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2885 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2943

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2944 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3002

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3003 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3041



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2279 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2338

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2339 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2397

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2398 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2456

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2457 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2516

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2517 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2576

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2577 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2633

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2634 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2692

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2752

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2753 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2812

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2813 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2871

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2872 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2930

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2931 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2969



 Score =  171 bits (433), Expect = 8e-41
 Identities = 102/699 (14%), Positives = 324/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1661 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1720

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1721 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1779

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1780 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1838

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D +     +  S  
Sbjct: 1839 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDS 1898

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1899 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1958

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 1959 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2016

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2017 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2076

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS++D+ +    DS++D+  D    +   S  
Sbjct: 2077 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2136

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2137 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2196

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2197 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2255

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2256 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2314

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2315 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2353



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2197 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2256

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2257 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2315

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2316 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2374

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2375 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2434

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2435 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2494

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2495 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2551

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2552 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2610

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2611 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2670

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2671 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2730

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2731 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2789

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2790 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2848

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2849 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2887



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2113 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2172

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2173 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2231

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2232 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2290

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2291 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2350

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2351 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2410

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2411 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2467

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2468 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2526

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2527 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2586

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2587 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2646

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2647 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2705

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2706 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2764

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2765 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2803



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2309 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2368

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2369 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2427

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2428 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2486

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2487 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2546

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2547 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2606

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2607 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2663

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2664 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2722

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2723 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2782

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2783 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2842

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2843 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2901

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2902 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2960

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2961 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2999



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2321 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2380

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2381 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2439

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2440 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2498

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2499 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2558

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2559 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2618

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2619 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2675

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2676 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2734

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2735 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2794

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2854

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2855 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2913

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2914 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2972

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2973 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3011



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2417 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2476

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2477 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2535

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2536 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2594

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2595 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2654

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2655 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2714

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2715 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2771

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2772 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2830

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2831 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2890

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2891 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2950

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2951 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3009

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3010 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3068

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3069 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3107



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2433 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2492

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2493 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2551

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2552 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2610

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2611 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2670

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2671 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2730

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2731 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2787

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2788 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2846

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2847 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2906

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2907 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2966

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2967 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3025

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3026 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3084

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3085 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3123



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2215 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2274

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2275 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2333

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2334 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2392

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2393 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2453 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2512

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2513 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2569

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2570 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2628

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2629 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2688

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2689 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2748

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2749 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2807

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2808 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2866

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2867 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2905



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2399 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2458

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2459 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2517

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2518 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2576

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2577 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2636

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2637 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2696

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2697 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2753

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2754 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2812

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2813 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2872

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2873 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2932

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2933 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2991

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2992 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3050

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3051 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3089



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2213 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2272

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2273 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2331

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2332 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2390

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2391 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2450

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2451 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2510

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2511 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2567

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2568 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2626

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2627 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2686

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2687 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2746

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2747 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2805

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2806 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2864

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2865 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2903



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2179 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2238

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2239 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2297

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2298 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2356

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2357 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2416

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2417 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2476

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2477 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2533

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2534 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2593 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2652

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2653 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2712

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2713 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2771

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2772 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2830

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2831 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2869



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2187 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2246

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2247 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2305

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2306 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2364

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2365 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2424

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2425 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2484

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2485 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2541

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2542 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2600

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2601 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2660

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2661 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2720

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2721 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2779

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2780 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2838

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2839 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2877



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2341 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2400

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2401 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2459

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2460 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2518

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2519 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2578

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2579 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2638

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2639 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2695

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2696 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2754

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2755 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2814

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2815 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2874

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2875 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2933

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2934 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2992

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2993 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3031



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2131 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2190

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2191 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2249

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2250 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2308

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2309 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2368

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2369 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2428

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2429 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2485

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2486 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2544

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2545 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2604

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2605 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2665 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2723

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2724 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2782

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2783 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2821



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2315 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2374

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2375 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2433

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2434 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2492

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2493 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2552

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2553 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2613 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2669

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2670 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2728

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2729 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2788

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2789 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2848

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2849 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2907

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2908 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2966

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2967 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3005



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2427 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2486

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2487 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2545

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2546 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2604

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2605 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2665 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2724

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2725 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2781

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2782 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2840

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2841 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2900

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2901 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2960

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2961 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3019

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3020 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3078

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3079 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3117



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2285 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2344

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2345 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2403

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2404 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2463 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2522

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2523 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2582

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2583 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2639

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2640 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2698

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2699 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2758

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2759 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2818

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2819 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2877

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2878 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2936

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2937 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2975



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2203 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2262

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2263 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2321

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2322 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2380

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2381 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2440

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2441 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2500

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2501 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2557

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2558 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2616

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2617 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2676

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2677 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2736

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2737 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2795

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2796 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2854

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2855 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2893



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2391 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2450

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2451 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2509

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2510 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2568

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2569 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2628

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2629 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2688

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2689 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2745

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2746 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2804

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2805 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2864

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2865 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2924

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2925 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2983

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2984 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3042

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3043 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3081



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2311 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2370

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2371 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2429

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2430 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2488

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2489 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2548

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2549 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2608

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2609 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2665

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2666 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2724

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2725 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2784

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2785 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2844

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2845 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2903

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2904 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2962

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2963 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3001



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2415 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2474

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2475 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2533

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2534 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2593 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2652

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2653 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2712

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2713 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2769

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2770 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2828

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2829 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2888

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2889 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2948

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2949 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3007

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3008 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3066

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3067 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3105



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2375 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2434

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2435 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2493

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2494 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2552

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2553 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2613 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2672

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2673 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2729

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2730 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2788

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2789 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2848

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2849 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2908

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2909 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2967

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2968 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3026

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3027 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3065



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2151 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2210

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2211 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2269

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2270 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2328

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2329 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2388

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2389 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2448

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2449 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2505

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2506 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2564

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2565 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2624

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2684

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2685 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2743

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2744 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2802

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2803 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2841



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2155 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2214

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2215 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2273

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2274 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2332

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2333 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2392

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2393 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2452

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2453 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2509

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2510 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2568

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2569 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2628

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2629 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2688

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2689 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2747

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2748 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2806

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2845



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2195 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2254

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2255 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2313

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2314 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2372

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2373 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2432

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2433 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2492

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2493 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2549

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2550 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2608

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2609 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2668

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2669 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2728

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2729 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2787

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2788 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2846

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2847 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2885



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2177 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2236

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2237 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2295

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2296 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2354

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2355 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2414

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2415 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2474

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2475 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2531

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2532 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2590

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2591 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2650

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2651 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2710

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2711 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2769

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2770 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2828

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2829 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2867



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2127 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2186

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2187 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2245

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2246 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2304

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2305 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2364

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2365 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2424

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2425 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2481

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2482 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2540

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2541 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2600

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2601 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2660

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2661 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2719

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2720 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2778

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2779 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2817



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2169 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2228

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2229 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2287

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2288 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2346

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2347 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2406

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2407 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2466

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2467 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2523

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2524 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2582

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2583 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2702

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2703 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2761

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2762 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2820

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2821 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2859



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2293 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2352

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2353 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2411

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2412 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2470

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2471 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2530

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2531 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2590

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2591 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2647

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2648 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2706

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2707 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2766

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2767 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2826

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2827 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2885

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2886 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2944

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2945 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2983



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2381 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2440

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2441 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2499

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2500 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2558

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2559 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2618

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2619 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2678

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2679 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2735

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2736 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2794

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2854

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2855 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2914

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2915 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2973

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2974 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3032

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3033 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3071



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1700

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1759

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1760 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1818

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1819 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1878

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D + +  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1879 DSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1938

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1939 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 1995

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 1996 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2054

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D   ++   S  
Sbjct: 2055 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDS 2114

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2115 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2174

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2175 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2233

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2234 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2292

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2293 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2331



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2265 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2324

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2325 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2383

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2384 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2442

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2443 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2502

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2503 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2562

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2563 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2619

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2620 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2678

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2679 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2738

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2739 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2798

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2799 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2857

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2858 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2916

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2917 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2955



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2353 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2412

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2413 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2471

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2472 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2530

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2531 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2590

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2591 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2650

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2651 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2707

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2708 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2766

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2767 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2826

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2827 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2886

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2887 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2945

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2946 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3004

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3005 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3043



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2301 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2360

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2361 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2419

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2420 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2478

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2479 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2538

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2539 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2598

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2599 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2655

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2656 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2714

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2715 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2774

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2775 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2834

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2835 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2893

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2894 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2952

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2953 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2991



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2397 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2456

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2457 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2515

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2516 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2574

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2575 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2634

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2635 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2694

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2695 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2751

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2752 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2810

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2811 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2870

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2871 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2930

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2931 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2989

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2990 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3048

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3049 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3087



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2259 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2318

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2319 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2377

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2378 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2436

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2437 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2496

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2497 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2556

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2557 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2613

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2614 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2672

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2673 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2732

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2733 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2792

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2793 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2851

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2852 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2910

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2911 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2949



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2157 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2216

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2217 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2275

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2276 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2334

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2335 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2394

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2395 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2454

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2455 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2511

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2512 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2570

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2571 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2630

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2631 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2690

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2691 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2749

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2750 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2808

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2809 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2847



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2283 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2342

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2343 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2401

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2402 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2460

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2461 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2520

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2521 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2580

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2581 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2637

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2638 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2696

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2697 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2756

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2757 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2816

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2817 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2875

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2876 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2934

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2935 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2973



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2211 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2270

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2271 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2329

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2330 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2388

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2389 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2448

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2449 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2508

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2509 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2565

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2566 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2624

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2684

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2685 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2744

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2745 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2803

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2804 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2862

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2863 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2901



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1903 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1962

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1963 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2021

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2022 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2080

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2081 DSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2140

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2141 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2200

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2201 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2257

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2258 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2316

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2317 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2376

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2377 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2436

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2437 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2495

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2496 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2554

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2555 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2593



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2371 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2430

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2431 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2489

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2490 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2548

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2549 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2608

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2609 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2668

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2669 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2725

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2726 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2784

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2785 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2844

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2845 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2904

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2905 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2963

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2964 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3022

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3023 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3061



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2135 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2194

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2195 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2253

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2254 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2312

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2313 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2372

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2373 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2432

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2433 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2489

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2490 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2548

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2549 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2608

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2609 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2668

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2669 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2727

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2728 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2786

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2787 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2825



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2153 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2212

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2213 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2271

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2272 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2330

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2331 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2390

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2391 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2450

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2451 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2507

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2508 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2566

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2567 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2626

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2627 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2686

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2687 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2745

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2746 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2804

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2805 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2843



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2205 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2264

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2265 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2323

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2324 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2382

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2383 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2442

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2443 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2502

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2503 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2559

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2560 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2618

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2619 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2678

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2679 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2738

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2739 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2797

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2798 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2856

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2857 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2895



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2435 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2494

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2495 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2553

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2554 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2613 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2672

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2673 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2732

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2733 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2789

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2790 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2848

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2849 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2908

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2909 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2968

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2969 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3027

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3028 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3086

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3087 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3125



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2249 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2308

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2309 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2367

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2368 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2426

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2427 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2486

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2487 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2546

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2547 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2603

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2604 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2662

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2663 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2722

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2723 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2782

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2783 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2841

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2842 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2900

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2901 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2939



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2389 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2448

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2449 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2507

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2508 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2566

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2567 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2626

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2627 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2686

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2687 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2743

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2744 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2802

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2803 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2862

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2863 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2922

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2923 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2981

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2982 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3040

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3041 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3079



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1941 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2000

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2001 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2059

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2060 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDS 2118

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2119 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2178

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2179 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2238

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2239 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2295

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2296 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2354

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2355 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2414

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2415 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2474

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2475 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2533

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2534 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2593 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2631



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2363 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2422

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2423 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2481

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2482 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2540

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2541 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2600

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2601 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2660

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2661 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2717

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2718 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2776

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2777 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2836

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2837 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2896

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2897 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2955

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2956 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3014

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3015 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3053



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2221 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2280

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2281 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2339

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2340 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2398

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2399 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2458

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2459 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2518

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2519 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2575

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2576 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2634

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2635 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2694

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2695 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2754

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2755 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2813

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2814 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2872

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2873 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2911



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2139 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2198

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2199 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2257

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2258 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2316

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2317 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2376

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2377 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2436

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2437 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2493

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2494 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2552

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2553 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2612

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2613 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2672

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2673 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2731

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2732 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2790

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2791 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2829



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2357 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2416

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2417 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2475

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2476 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2534

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2535 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2594

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2595 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2654

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2655 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2711

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2712 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2770

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2771 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2830

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2831 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2890

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2891 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2949

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2950 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3008

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3009 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3047



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 330/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1725 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1784

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1785 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1843

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D++        S  +++ 
Sbjct: 1844 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDS 1902

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1903 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1962

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1963 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2022

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2023 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2079

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2080 SDSDSDSDSDSDSD-SDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2138

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2139 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2198

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2199 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2258

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2259 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2317

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2318 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2376

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2377 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2415



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2159 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2218

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2219 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2277

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2278 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2336

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2337 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2396

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2397 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2456

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2457 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2513

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2514 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2572

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2573 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2632

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2633 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2692

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2693 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2751

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2752 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2810

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2811 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2849



 Score =  171 bits (433), Expect = 8e-41
 Identities = 102/699 (14%), Positives = 324/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1719 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1778

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1779 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1837

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1838 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDS 1896

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1897 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1956

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1957 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2016

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2017 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2074

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2075 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDS 2134

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2135 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2194

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2195 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2254

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2255 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2313

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2314 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2372

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2373 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2411



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1967 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2026

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2027 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2085

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2086 SDSDSDSDSDSDSDSD-SDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2144

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2145 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2204

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2205 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2264

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2265 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2321

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2322 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2380

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2381 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2440

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2441 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2500

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2501 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2559

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2560 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2618

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2619 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2657



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2327 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2386

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2387 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2445

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2446 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2504

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2505 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2564

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2565 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2624

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2625 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2681

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2682 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2740

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2741 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2800

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2801 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2860

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2861 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2919

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2920 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2978

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2979 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3017



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2255 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2314

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2315 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2373

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2374 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2432

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2433 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2492

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2493 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2552

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2553 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2609

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2610 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2668

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2669 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2728

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2729 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2788

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2789 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2847

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2848 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2906

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2907 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2945



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2161 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2220

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2221 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2279

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2280 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2338

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2339 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2398

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2399 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2458

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2459 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2515

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2516 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2574

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2575 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2634

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2635 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2694

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2695 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2753

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2754 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2812

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2813 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2851



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2337 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2396

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2397 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2455

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2456 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2514

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2515 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2574

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2575 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2634

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2635 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2691

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2692 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2750

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2751 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2810

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2811 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2870

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2871 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2929

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2930 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2988

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2989 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3027



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2117 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2176

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2177 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2235

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2236 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2294

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2295 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2354

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2355 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2414

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2415 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2471

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2472 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2530

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2531 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2590

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2591 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2650

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2651 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2709

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2710 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2768

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2769 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2807



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2201 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2260

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2261 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2319

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2320 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2378

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2379 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2438

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2439 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2498

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2499 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2555

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2556 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2614

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2615 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2674

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2734

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2735 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2793

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2794 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2852

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2853 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2891



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2387 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2446

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2447 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2505

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2506 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2564

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2565 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2624

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2684

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2685 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2741

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2742 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2800

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2801 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2860

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2861 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2920

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2921 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2979

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2980 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3038

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3039 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3077



 Score =  171 bits (433), Expect = 8e-41
 Identities = 102/699 (14%), Positives = 323/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1713 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1772

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1773 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1831

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  + + 
Sbjct: 1832 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDS 1890

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1891 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1950

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1951 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2010

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2011 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2068

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2069 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 2128

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2129 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2188

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2189 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2248

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2249 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2307

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2308 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2366

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2367 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2405



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2297 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2356

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2357 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2415

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2416 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2474

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2475 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2534

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2535 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2594

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2595 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2651

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2652 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2710

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2711 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2770

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2771 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2830

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2831 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2889

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2890 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2948

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2949 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2987



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2423 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2482

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2483 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2541

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2542 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2600

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2601 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2660

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2661 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2720

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2721 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2777

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2778 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2836

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2837 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2896

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2897 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2956

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2957 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3015

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3016 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3074

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3075 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3113



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2349 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2408

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2409 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2467

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2468 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2526

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2527 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2586

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2587 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2646

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2647 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2703

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2704 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2762

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2763 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2822

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2823 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2882

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2883 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2941

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2942 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3000

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3001 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3039



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2173 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2232

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2233 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2291

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2292 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2350

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2351 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2410

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2411 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2470

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2471 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2527

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2528 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2586

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2587 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2646

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2647 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2706

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2707 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2765

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2766 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2824

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2825 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2863



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2429 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2488

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2489 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2547

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2548 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2606

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2607 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2666

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2667 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2726

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2727 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2783

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2784 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2842

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2843 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2902

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2903 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2962

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2963 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3021

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3022 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3080

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3081 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3119



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2167 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2226

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2227 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2285

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2286 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2344

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2345 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2404

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2405 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2464

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2465 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2521

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2522 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2580

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2581 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2701 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2759

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2760 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2818

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2819 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2857



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2219 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2278

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2279 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2337

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2338 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2396

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2397 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2456

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2457 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2516

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2517 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2573

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2574 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2632

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2633 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2692

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2752

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2753 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2811

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2812 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2870

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2871 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2909



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2385 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2444

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2445 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2503

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2504 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2562

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2563 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2622

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2623 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2682

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2683 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2739

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2740 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2798

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2799 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2858

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2859 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2918

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2919 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2977

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2978 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3036

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3037 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3075



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2377 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2436

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2437 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2495

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2496 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2554

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2555 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2614

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2615 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2674

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2675 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2731

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2732 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2790

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2791 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2850

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2851 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2910

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2911 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2969

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2970 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3028

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3029 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3067



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2395 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2454

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2455 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2513

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2514 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2572

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2573 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2632

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2633 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2692

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2693 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2749

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2750 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2808

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2809 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2868

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2869 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2928

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2929 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2987

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2988 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3046

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3085



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2235 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2294

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2295 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2353

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2354 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2412

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2413 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2472

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2473 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2532

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2533 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2589

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2590 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2649 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2708

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2709 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2768

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2769 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2827

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2828 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2886

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2887 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2925



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2431 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2490

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2491 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2549

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2550 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2608

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2609 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2668

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2669 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2728

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2729 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2785

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2786 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2844

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2845 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2904

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2905 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2964

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2965 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3023

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3024 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3082

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3083 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3121



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2175 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2234

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2235 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2293

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2294 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2352

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2353 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2412

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2413 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2472

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2473 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2529

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2530 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2588

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2589 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2649 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2708

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2709 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2767

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2768 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2826

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2827 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2865



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2145 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2204

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2205 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2263

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2264 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2322

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2323 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2382

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2383 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2442

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2443 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2499

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2500 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2558

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2559 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2618

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2619 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2678

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2679 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2737

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2738 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2796

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2835



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2277 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2336

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2337 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2395

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2396 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2454

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2455 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2514

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2515 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2574

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2575 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2631

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2632 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2690

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2750

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2751 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2810

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2811 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2869

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2870 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2928

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2929 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2967



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2237 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2296

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2297 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2355

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2356 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2414

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2415 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2474

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2475 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2534

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2535 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2591

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2592 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2650

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2651 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2710

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2711 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2770

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2771 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2829

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2830 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2888

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2889 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2927



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2147 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2206

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2207 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2265

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2266 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2324

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2325 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2384

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2385 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2444

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2445 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2501

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2502 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2560

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2561 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2621 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2680

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2681 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2739

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2740 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2798

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2799 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2837



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2325 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2384

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2385 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2443

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2444 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2502

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2503 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2562

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2563 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2622

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2623 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2679

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2680 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2738

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2739 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2798

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2799 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2858

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2859 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2917

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2918 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2976

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2977 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3015



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2369 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2428

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2429 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2487

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2488 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2546

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2547 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2606

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2607 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2666

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2667 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2723

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2724 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2782

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2783 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2842

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2843 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2902

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2903 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2961

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2962 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3020

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3021 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3059



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2171 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2230

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2231 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2289

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2290 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2348

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2349 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2408

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2409 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2468

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2469 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2525

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2526 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2584

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2585 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2644

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2645 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2704

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2705 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2763

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2764 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2822

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2823 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2861



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2345 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2404

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2405 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2463

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2464 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2522

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2523 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2582

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2583 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2643 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2699

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2700 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2758

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2759 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2818

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2819 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2878

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2879 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2937

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2938 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2996

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2997 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3035



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2271 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2330

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2331 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2389

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2390 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2448

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2449 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2508

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2509 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2568

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2569 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2625

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2626 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2684

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2685 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2744

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2745 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2804

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2805 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2863

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2864 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2922

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2923 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2961



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2245 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2304

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2305 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2363

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2364 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2422

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2423 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2482

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2483 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2542

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2543 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2599

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2600 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2658

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2718

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2719 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2778

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2779 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2837

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2838 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2896

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2897 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2935



 Score =  171 bits (433), Expect = 8e-41
 Identities = 102/699 (14%), Positives = 326/699 (46%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1755 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1814

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1815 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1873

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++    +  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1874 SDSDSDSDSDSDSDGD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1932

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1933 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1992

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1993 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2052

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++    ++ +     +  S 
Sbjct: 2053 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSD 2111

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2112 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2170

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2171 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2230

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2231 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2290

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2291 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2349

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2350 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2408

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2409 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2447



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2411 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2470

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2471 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2529

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2530 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2588

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2589 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2649 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2708

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2709 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2765

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2766 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2824

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2825 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2884

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2885 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2944

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2945 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3003

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3004 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3062

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3063 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3101



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2347 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2406

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2407 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2465

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2466 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2524

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2525 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2584

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2585 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2644

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2645 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2701

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2702 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2760

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2761 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2820

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2821 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2880

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2881 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2939

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2940 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2998

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2999 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3037



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2119 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2178

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2179 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2237

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2238 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2296

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2297 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2356

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2357 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2416

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2417 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2473

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2474 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2532

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2533 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2593 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2652

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2653 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2711

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2712 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2770

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2771 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2809



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2241 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2300

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2301 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2359

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2360 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2418

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2419 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2478

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2479 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2538

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2539 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2595

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2596 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2654

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2655 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2714

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2715 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2774

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2775 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2833

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2834 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2892

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2893 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2931



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2143 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2202

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2203 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2261

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2262 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2320

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2321 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2380

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2381 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2440

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2441 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2497

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2498 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2556

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2557 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2616

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2617 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2676

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2677 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2735

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2736 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2794

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2833



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2403 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2462

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2463 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2521

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2522 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2580

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2581 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2701 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2757

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2758 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2816

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2817 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2876

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2877 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2936

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2937 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2995

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2996 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3054

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3055 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3093



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2273 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2332

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2333 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2391

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2392 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2450

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2451 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2510

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2511 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2570

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2571 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2627

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2628 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2686

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2687 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2746

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2747 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2806

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2807 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2865

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2866 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2924

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2925 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2963



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2183 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2242

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2243 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2301

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2302 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2360

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2361 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2420

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2421 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2480

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2481 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2537

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2538 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2596

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2597 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2657 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2716

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2717 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2775

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2776 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2834

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2835 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2873



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2343 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2402

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2403 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2461

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2462 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2520

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2521 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2580

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2581 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2641 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2697

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2698 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2756

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2757 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2816

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2817 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2876

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2877 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2935

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2936 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2994

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2995 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3033



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2227 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2286

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2287 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2345

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2346 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2404

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2405 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2464

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2465 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2524

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2525 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2581

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2582 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2760

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2761 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2819

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2820 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2878

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2879 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2917



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2231 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2290

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2291 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2349

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2350 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2408

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2409 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2468

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2469 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2528

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2529 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2585

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2586 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2644

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2645 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2704

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2705 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2764

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2765 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2823

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2824 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2882

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2883 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2921



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2323 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2382

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2383 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2441

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2442 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2500

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2501 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2560

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2561 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2621 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2677

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2678 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2736

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2737 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2796

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2856

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2857 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2915

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2916 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2974

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2975 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3013



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2267 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2326

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2327 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2385

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2386 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2444

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2445 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2504

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2505 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2564

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2565 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2621

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2622 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2680

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2681 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2740

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2741 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2800

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2801 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2859

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2860 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2918

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2919 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2957



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2281 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2340

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2341 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2399

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2400 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2458

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2459 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2518

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2519 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2578

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2579 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2635

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2636 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2694

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2695 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2754

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2755 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2814

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2815 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2873

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2874 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2932

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2933 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2971



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2149 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2208

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2209 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2267

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2268 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2326

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2327 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2386

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2387 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2446

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2447 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2503

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2504 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2562

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2563 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2622

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2623 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2682

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2683 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2741

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2742 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2800

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2801 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2839



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2291 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2350

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2351 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2409

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2410 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2468

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2469 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2528

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2529 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2588

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2589 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2645

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2646 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2704

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2705 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2764

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2765 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2824

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2825 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2883

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2884 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2942

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2943 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2981



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2383 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2442

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2443 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2501

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2502 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2560

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2561 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2621 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2680

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2681 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2737

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2738 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2796

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2856

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2857 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2916

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2917 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2975

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2976 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3034

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3035 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3073



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2333 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2392

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2393 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2451

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2452 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2510

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2511 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2570

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2571 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2630

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2631 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2687

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2688 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2746

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2747 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2806

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2866

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2867 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2925

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2926 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2984

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2985 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3023



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2295 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2354

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2355 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2413

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2414 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2472

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2473 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2532

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2533 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2592

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2593 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2649

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2650 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2708

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2709 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2768

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2769 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2828

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2829 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2887

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2888 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2946

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2947 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2985



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2239 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2298

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2299 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2357

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2358 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2416

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2417 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2476

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2477 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2536

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2537 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2593

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2594 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2652

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2653 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2712

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2713 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2772

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2773 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2831

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2832 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2890

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2891 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2929



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2367 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2426

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2427 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2485

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2486 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2544

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2545 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2604

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2605 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2665 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2721

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2722 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2780

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2781 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2840

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2841 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2900

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2901 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2959

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2960 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3018

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3019 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3057



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2223 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2282

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2283 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2341

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2342 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2400

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2401 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2460

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2461 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2520

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2521 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2577

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2578 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2636

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2637 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2696

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2697 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2756

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2757 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2815

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2816 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2874

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2875 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2913



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2329 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2388

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2389 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2447

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2448 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2506

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2507 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2566

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2567 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2626

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2627 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2683

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2684 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2742

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2743 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2802

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2803 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2862

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2863 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2921

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2922 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2980

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2981 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3019



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2299 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2358

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2359 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2417

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2418 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2476

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2477 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2536

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2537 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2596

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2597 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2653

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2654 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2712

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2713 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2772

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2773 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2832

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2833 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2891

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2892 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2950

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2951 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2989



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2319 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2378

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2379 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2437

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2438 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2496

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2497 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2556

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2557 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2616

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2617 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2673

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2674 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2732

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2733 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2792

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2793 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2852

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2853 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2911

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2912 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2970

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2971 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3009



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2207 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2266

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2267 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2325

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2326 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2384

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2385 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2444

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2445 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2504

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2505 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2561

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2562 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2620

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2621 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2680

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2681 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2740

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2741 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2799

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2800 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2858

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2859 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2897



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1865 DSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1924

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1925 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1983

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1984 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2042

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2043 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2102

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2103 DSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2162

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2163 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2219

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2220 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2278

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2279 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2338

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2339 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2398

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2399 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2457

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2458 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2516

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2517 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2555



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2313 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2372

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2373 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2431

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2432 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2490

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2491 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2550

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2551 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2610

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2611 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2667

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2668 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2726

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2727 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2786

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2787 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2846

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2847 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2905

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2906 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2964

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2965 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3003



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2359 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2418

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2419 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2477

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2478 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2536

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2537 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2596

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2597 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2657 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2713

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2714 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2772

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2773 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2832

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2833 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2892

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2893 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2951

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2952 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3010

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3011 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3049



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2419 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2478

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2479 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2537

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2538 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2596

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2597 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2657 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2716

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2717 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2773

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2774 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2832

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2833 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2892

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2893 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2952

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2953 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3011

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3012 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3070

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3071 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3109



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2251 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2310

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2311 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2369

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2370 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2428

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2429 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2488

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2489 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2548

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2549 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2605

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2606 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2664

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2665 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2724

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2725 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2784

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2785 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2843

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2844 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2902

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2903 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2941



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2317 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2376

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2377 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2435

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2436 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2494

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2495 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2554

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2555 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2614

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2615 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2671

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2672 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2730

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2731 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2790

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2791 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2850

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2851 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2909

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2910 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2968

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2969 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3007



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2379 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2438

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2439 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2497

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2498 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2556

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2557 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2616

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2617 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2676

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2677 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2733

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2734 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2792

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2793 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2852

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2853 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2912

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2913 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2971

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2972 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3030

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3031 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3069



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2243 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2302

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2303 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2361

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2362 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2420

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2421 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2480

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2481 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2540

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2541 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2597

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2598 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2656

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2657 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2716

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2717 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2776

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2777 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2835

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2836 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2894

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2895 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2933



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2289 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2348

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2349 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2407

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2408 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2466

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2467 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2526

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2527 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2586

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2587 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2643

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2644 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2702

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2703 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2762

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2763 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2822

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2823 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2881

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2882 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2940

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2941 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2979



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2263 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2322

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2323 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2381

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2382 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2440

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2441 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2500

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2501 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2560

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2561 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2617

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2618 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2676

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2677 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2736

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2737 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2796

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2797 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2855

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2856 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2914

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2915 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2953



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2401 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2460

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2461 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2519

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2520 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2578

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2579 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2638

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2639 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2698

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2699 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2755

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2756 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2814

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2815 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2874

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2875 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2934

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2935 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2993

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2994 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3052

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3053 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3091



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2437 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2496

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2497 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2555

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2556 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2614

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2615 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2674

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2734

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2735 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2791

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2792 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2850

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2851 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2910

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2911 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2970

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2971 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3029

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3030 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3088

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3089 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3127



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2257 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2316

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2317 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2375

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2376 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2434

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2435 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2494

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2495 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2554

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2555 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2611

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2612 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2670

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2671 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2730

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2731 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2790

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2791 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2849

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2850 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2908

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2909 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2947



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2115 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2174

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2175 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2233

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2234 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2292

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2293 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2352

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2353 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2412

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2413 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2469

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2470 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2528

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2529 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2588

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2589 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2649 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2707

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2708 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2766

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2767 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2805



 Score =  171 bits (433), Expect = 8e-41
 Identities = 104/699 (14%), Positives = 323/699 (45%), Gaps = 8/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2481 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2540

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2541 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2599

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2600 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2658

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2718

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2719 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2778

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2779 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2836

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2837 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2896

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2897 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2956

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2957 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3016

Query: 619  NTDSVQNDNVNSDG-SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            ++DS  + + +SD  S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 3017 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3076

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 3077 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3135

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
                S   S ++   +S  D  T  +SN  +N  + S++
Sbjct: 3136 ADSDSDSDSDSDSNNDSDSDTITDSDSNDGTNSDNGSNS 3174



 Score =  171 bits (433), Expect = 8e-41
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2407 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2466

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2467 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2525

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2526 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2584

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2585 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2644

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2645 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2704

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2705 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2761

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2762 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2820

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2821 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2880

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2881 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2940

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2941 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2999

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 3000 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3058

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 3059 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3097



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1853 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDS 1912

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1913 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1971

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1972 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2030

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2031 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2090

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2091 DSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2150

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2151 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2207

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2208 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2266

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2267 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2326

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2327 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2386

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2387 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2445

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2446 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2504

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2505 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2543



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1815 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1874

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 1875 DSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1934

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1935 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1993

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 1994 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2053

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2054 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSD 2113

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2114 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2170

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2171 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2229

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2230 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2289

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2290 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2349

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2350 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2408

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2409 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2467

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2468 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2507



 Score =  171 bits (432), Expect = 1e-40
 Identities = 103/700 (14%), Positives = 325/700 (45%), Gaps = 8/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1731 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1790

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1791 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1849

Query: 200  ENEENKHEAENKEAAEVHEEK-SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
             + ++  ++++   ++   +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1850 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSD 1909

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 1910 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1969

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 1970 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2029

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++    ++ +        S
Sbjct: 2030 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2088

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++   N  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2089 DSDSDSDSDSDSDSDSDSN-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2147

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2148 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2207

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2208 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2267

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2268 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2326

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2327 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2385

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2386 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2425



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 332/699 (47%), Gaps = 12/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1833 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDS 1892

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1893 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSD 1949

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1950 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2008

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2009 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2068

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + + ++ ++++ +       ++ S+ 
Sbjct: 2069 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 2128

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2129 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2185

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2186 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2244

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2245 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2304

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2305 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2364

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2365 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2423

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2424 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2482

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2483 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2521



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 329/699 (47%), Gaps = 12/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1881 DSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1940

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1941 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDS--- 1996

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1997 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2056

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2057 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDS 2116

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2117 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2176

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2177 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2233

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2234 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2292

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2293 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2352

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2353 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2412

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2413 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2471

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2472 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2530

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2531 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2569



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/700 (15%), Positives = 330/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ +   +   
Sbjct: 1835 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDS 1894

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1895 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1953

Query: 200  ENEENKHEAENKEAAEVHEEK-SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
             + ++  ++++   ++   +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1954 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2013

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2014 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2073

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2074 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSD 2133

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2134 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2190

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2191 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2249

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2250 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2309

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2310 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2369

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2370 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2428

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2429 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2487

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2488 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2527



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1718

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1719 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1777

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1778 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1836

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1837 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDS 1896

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1897 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1956

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1957 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2013

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2014 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2072

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2073 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDS 2132

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2133 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2192

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2193 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2251

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2252 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2310

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2311 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2349



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/701 (14%), Positives = 332/701 (46%), Gaps = 10/701 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1825 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1884

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 1885 DSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1944

Query: 199  KENEENKHEAENKEAAEVHEEK-SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQEN 257
              + ++  ++++   ++   +  S  +++   D +++   +   D+++       S  ++
Sbjct: 1945 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2004

Query: 258  EETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKS 317
            +   D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S
Sbjct: 2005 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2064

Query: 318  RQENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASS 377
              +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S
Sbjct: 2065 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDS 2124

Query: 378  EKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQK 437
            +    D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  
Sbjct: 2125 DSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD- 2181

Query: 438  SGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETV 496
            S ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     
Sbjct: 2182 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2240

Query: 497  DSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSS 556
            DS S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S
Sbjct: 2241 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2300

Query: 557  SGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNA 616
              +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++
Sbjct: 2301 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2360

Query: 617  ETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQN 676
            ++++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +
Sbjct: 2361 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2419

Query: 677  GSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNT 736
              + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S++
Sbjct: 2420 SDSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2478

Query: 737  NDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
            +    S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2479 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2519



 Score =  171 bits (432), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1697 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1756

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1757 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1815

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1816 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1874

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1875 DSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1934

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1935 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1994

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 1995 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2051

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2052 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDS 2110

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2111 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2170

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2171 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2230

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2231 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2289

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2290 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2348

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2349 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2387



 Score =  170 bits (431), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 331/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1729 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1788

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1789 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1847

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1848 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDS 1906

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 1907 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1966

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 1967 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2026

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2027 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2083

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2084 SDSDSDSDSDSDSD-SDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2142

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2143 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2202

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2203 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2262

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2263 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2321

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2322 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2380

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2381 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2419



 Score =  170 bits (431), Expect = 1e-40
 Identities = 105/699 (15%), Positives = 330/699 (47%), Gaps = 10/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D  S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2103 DSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2162

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2163 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2221

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2222 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2280

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2281 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2340

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2341 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2400

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2401 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2457

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2458 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2516

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2517 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2576

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2577 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2636

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2637 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2695

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2696 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2754

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2755 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2793



 Score =  170 bits (431), Expect = 1e-40
 Identities = 105/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1811 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1870

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1871 DSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 1929

Query: 200  ENEENKHEAENKEAAEVHEEK-SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
             + ++  ++++   ++   +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1930 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1989

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 1990 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2049

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       +++S+
Sbjct: 2050 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSD 2109

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2110 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2166

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2167 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2225

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2226 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2285

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2286 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2345

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2346 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2404

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2405 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2463

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2464 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2503



 Score =  170 bits (431), Expect = 1e-40
 Identities = 104/698 (14%), Positives = 334/698 (46%), Gaps = 10/698 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLDDANGVDENEVENKPEEHIK 140
            + D +S+ +S ++   + D  +S  +++ +   + +     D++   +++ ++  +    
Sbjct: 1859 DSDSDSDSDSDSDSDSDSDS-DSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1917

Query: 141  LDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVKE 200
             D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS    
Sbjct: 1918 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSDS 1976

Query: 201  NEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEET 260
            + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++  
Sbjct: 1977 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2035

Query: 261  KDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQE 320
             D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  +
Sbjct: 2036 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2095

Query: 321  NEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQ 380
            ++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+  
Sbjct: 2096 SDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2155

Query: 381  VQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGT 440
              D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S +
Sbjct: 2156 -SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SDS 2212

Query: 441  ETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDSS 499
            +++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS 
Sbjct: 2213 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2271

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
            S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  +
Sbjct: 2272 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2331

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++++
Sbjct: 2332 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2391

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  +
Sbjct: 2392 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2450

Query: 680  SNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQ 739
             +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++  
Sbjct: 2451 DSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2509

Query: 740  GSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
              S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2510 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2547



 Score =  170 bits (431), Expect = 1e-40
 Identities = 105/700 (15%), Positives = 332/700 (47%), Gaps = 10/700 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 1875 DSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1934

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGE-ESDNTESKENDSLV 198
              D  +  D +S+   D        S  ++ +D +S+   +   + +SD+    ++DS  
Sbjct: 1935 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1994

Query: 199  KENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
              + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++
Sbjct: 1995 DSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2053

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2054 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSD 2113

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2114 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2173

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S
Sbjct: 2174 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-S 2230

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
             ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2231 DSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2289

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 2290 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2349

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 2350 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2409

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ + 
Sbjct: 2410 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2468

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTN 737
             + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++
Sbjct: 2469 DSDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2527

Query: 738  DQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
                S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2528 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2567



 Score =  169 bits (429), Expect = 2e-40
 Identities = 107/700 (15%), Positives = 323/700 (45%), Gaps = 17/700 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2521 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2580

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 2581 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2640

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2641 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2700

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2760

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2761 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2820

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2821 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2877

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2878 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2936

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2937 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2996

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2997 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3056

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 3057 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3115

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKD----ESAHSDEGSN- 733
            + +++D+ + S D++ + +S     S++D ++  N   +S+   D    +  +SD GSN 
Sbjct: 3116 SDSDSDSDSDS-DSDSDSDSDADSDSDSDSDSDSNNDSDSDTITDSDSNDGTNSDNGSNS 3174

Query: 734  ----SNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESN 769
                S++++ GS S  +       S    GT   S A +N
Sbjct: 3175 GSDGSSSSNTGSGSGNTTGSTGNNSGTGTGTTTSSTASNN 3214



 Score =  169 bits (429), Expect = 2e-40
 Identities = 104/699 (14%), Positives = 333/699 (46%), Gaps = 12/699 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVD-ENEPEHKPEEEHIKLDDANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +++ +   + +     D++   +++ ++  +   
Sbjct: 1863 DSDSDSDSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1922

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 1923 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSD 1979

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 1980 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2038

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2039 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2098

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D  ++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2099 DSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2158

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2159 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2215

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2216 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2274

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2275 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2334

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 2335 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2394

Query: 619  NTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS 678
            ++DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S+S++ SD++ +  
Sbjct: 2395 DSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2453

Query: 679  NSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEGSNSNTND 738
            + +++D+ + S D++ + +S     S++D ++  +   +S+   D  + SD  S+S+++ 
Sbjct: 2454 SDSDSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2512

Query: 739  QGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSAE 777
               S   S ++   +S  D  +  +S+++S+    S ++
Sbjct: 2513 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2551



 Score =  165 bits (417), Expect = 5e-39
 Identities = 120/733 (16%), Positives = 327/733 (44%), Gaps = 25/733 (3%)

Query: 53   TGNDVVRLGRKDLNPLVEETTVVDARHKEQ----DEESEHESKTEEQINLDEVNSVDENE 108
            T    V LGR  L      T   D+   E     ++ +E+ S      N+    +   +E
Sbjct: 1404 TTTTTVTLGRAYLTVNAVSTEAADSAASEAANYANQATEYGSVASSYANIAGEYASKNSE 1463

Query: 109  PEHKPEEEHIKLDDANGVD---ENEVENKPEEHIKLDDANGVDENSEHSQDLVEHEGEGS 165
                 E+      DA            N        D A    ENS  S    E   + +
Sbjct: 1464 ASSYAEQATAAASDAQSAATAASTAASNAAAAQSNADSAEAAGENSAASS-YAEEAKKKA 1522

Query: 166  SENARTDIESEQHVEKVGEESDNTESKENDSLVKENEENKHEAENKEAAEVHEEKSQQEN 225
            SE +    ++    +  G  +D   +   D    +++ +     + ++    +  S  ++
Sbjct: 1523 SEASEAKKKASSAADDAGYYADLAANVSEDDSDSDSDGDSDSDSDSDSDSDSDSDSDSDS 1582

Query: 226  EETKDKENEEIKNEVEDTEAGEVKVEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKS 285
            +   D +++   +   D+++       S  +++   D +++   +   D ++    +  S
Sbjct: 1583 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1642

Query: 286  QQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQENEETKDKENEEINQNGTDVKDHVEE 345
              +++   D +++   +   D ++    +  S  +++   D +++  + + +D     + 
Sbjct: 1643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1702

Query: 346  NHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEKQVQDGEGNNEQHREENYAGDNASSAV 405
            + + DS  + +  + ++++ +       ++ S+    D + +++   + +   D+ S + 
Sbjct: 1703 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSD 1761

Query: 406  DHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQENGGENQAQT 465
                 D  ++S       D +  ++S+ +S  S ++++  +DS++ ++  ++  ++ + +
Sbjct: 1762 SDSDSDSDSDS-------DSDSDSDSDSDSD-SDSDSDSDSDSDSDSD-SDSDSDSDSDS 1812

Query: 466  DNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKV 525
            D+ S+  S S+S      + ++  SD     DS S + +++ S + D  +++  D++S  
Sbjct: 1813 DSDSDSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDS-- 1868

Query: 526  EDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNS 585
             DS +D+ +    DS++D+ GD    +   S  +SDS++++ +  ++ +   +++ + + 
Sbjct: 1869 -DSDSDSDSDSDSDSDSDSDGDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1927

Query: 586  VQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDG-SNTNSEGSANDN 644
                    S     + SD+ S+   D  S++++++DS  + + +SD  S+++S+  ++ +
Sbjct: 1928 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1987

Query: 645  KEASQVNSSDVSSEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTS 704
             ++   + SD  S+   +  S+S++ SD++ +  + +++D+ + S D++ + +S     S
Sbjct: 1988 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDS 2046

Query: 705  ENDGEAAQNESVESEKAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPES 764
            ++D ++  +   +S+   D  + SD  S+S+++    S   S ++   +S  D  +  +S
Sbjct: 2047 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2106

Query: 765  NAESNHRDVSSAE 777
            N++S+    S ++
Sbjct: 2107 NSDSDSDSDSDSD 2119



 Score =  164 bits (414), Expect = 1e-38
 Identities = 117/706 (16%), Positives = 319/706 (44%), Gaps = 26/706 (3%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2684

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 2685 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2744

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2745 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2804

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2805 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2864

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2865 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2924

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2925 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2981

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2982 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3040

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 3041 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3100

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   + + + +S  +   D+  +A  + SD+ S+   +  S+++T
Sbjct: 3101 DSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSDSDSDAD-SDSDSDSDSDSNNDSDSDT 3156

Query: 619  NTDSVQNDNVNSD-GSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
             TDS  ND  NSD GSN+ S+GS++ N  +   N++  +   S  G+  +  SS A+ NG
Sbjct: 3157 ITDSDSNDGTNSDNGSNSGSDGSSSSNTGSGSGNTTGSTGNNSGTGTGTT-TSSTASNNG 3215

Query: 678  --SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESE------KAKDESAHSD 729
              S S  + +  A+   +    ++   T  +DG A  + +  +        A+D  A SD
Sbjct: 3216 AASTSTTSLSAAATSGVSATAATLAVTTPSSDGAATTSATAATSVVYAAASAQDVDATSD 3275

Query: 730  E------GSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESN 769
            +       SN +  D+ S+   S  ++V  S+ D      S+  +N
Sbjct: 3276 QTDSDSKSSNDSDKDKKSADTDSADDKVGSSNTDENGKTASDTSNN 3321



 Score =  159 bits (401), Expect = 4e-37
 Identities = 102/671 (15%), Positives = 313/671 (46%), Gaps = 19/671 (2%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2565 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2624

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDS--- 2680

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2681 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2740

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2741 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2800

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2801 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2860

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2861 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 2917

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS 499
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++  SD     DS 
Sbjct: 2918 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSD 2975

Query: 500  SQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSGN 559
            S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  +
Sbjct: 2976 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3035

Query: 560  SDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETN 619
            SDS++++ +  ++ +   + + + +S  +   D+  ++    SD+ S+   D  S+++++
Sbjct: 3036 SDSDSDSDSDSDSDS---DSDSDSDSDSDSDSDSDSDSD---SDSDSDSDSDSDSDSDSD 3089

Query: 620  TDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGSN 679
            +DS  + + +SD S+++S+  ++ + ++   + SD  S+   +  S++++ SD++ +  +
Sbjct: 3090 SDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDSDSDSDS 3148

Query: 680  SNENDNGN-ASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESA-HSDEGSNSNTN 737
            +N++D+      D+N+  NS     S +DG ++ N    S      +  +S  G+ + T+
Sbjct: 3149 NNDSDSDTITDSDSNDGTNSDNGSNSGSDGSSSSNTGSGSGNTTGSTGNNSGTGTGTTTS 3208

Query: 738  DQGSSSDPSIT 748
               S++  + T
Sbjct: 3209 STASNNGAAST 3219



 Score =  154 bits (389), Expect = 1e-35
 Identities = 91/644 (14%), Positives = 290/644 (44%), Gaps = 7/644 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2589 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2648

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2649 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2707

Query: 200  ENEENKHEAENKEAAEVHEEK-SQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENE 258
             + ++  ++++   ++   +  S  +++   D +++   +   D+++       S  +++
Sbjct: 2708 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2767

Query: 259  ETKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSR 318
               D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S 
Sbjct: 2768 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2827

Query: 319  QENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSE 378
             +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+
Sbjct: 2828 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 2887

Query: 379  KQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKS 438
                D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S   
Sbjct: 2888 SD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSD 2945

Query: 439  GTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVD 497
                ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     D
Sbjct: 2946 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3005

Query: 498  SSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSS 557
            S S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S 
Sbjct: 3006 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3065

Query: 558  GNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAE 617
             +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S+++
Sbjct: 3066 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 3125

Query: 618  TNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            +++DS  + + +SD S+++S+  +N++ ++  +  SD +   + +  SNS +   ++ N 
Sbjct: 3126 SDSDSDSDSDADSD-SDSDSDSDSNNDSDSDTITDSDSNDGTNSDNGSNSGSDGSSSSNT 3184

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKA 721
             + + N  G+  +++     +    T+ N+G A+ + +  S  A
Sbjct: 3185 GSGSGNTTGSTGNNSGTGTGTTTSSTASNNGAASTSTTSLSAAA 3228



 Score =  153 bits (387), Expect = 2e-35
 Identities = 95/654 (14%), Positives = 290/654 (43%), Gaps = 8/654 (1%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2583 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2642

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +    +SD+    ++DS   
Sbjct: 2643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDSD 2701

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
             + ++  ++++   ++  +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2702 SDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2760

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2761 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2820

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2821 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2880

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S    
Sbjct: 2881 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSDSDS 2938

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
               ++    + + +  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 2939 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2998

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D+ +    DS++D+  D    +   S  
Sbjct: 2999 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3058

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            +SDS++++ +  ++ +   +++ + +         S     + SD+ S+   D  S++++
Sbjct: 3059 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3118

Query: 619  NTDSVQNDNVNSDG-SNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNG 677
            ++DS  + + +SD  S+ +S+  ++ + +++  + SD  ++      +NS+N S++  +G
Sbjct: 3119 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSNNDSDSDTITDSDSNDGTNSDNGSNSGSDG 3178

Query: 678  SNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESAHSDEG 731
            S+S+   +G+ +   +   NS    T       A N    S      SA +  G
Sbjct: 3179 SSSSNTGSGSGNTTGSTGNNS-GTGTGTTTSSTASNNGAASTSTTSLSAAATSG 3231



 Score =  135 bits (341), Expect = 4e-30
 Identities = 92/643 (14%), Positives = 267/643 (41%), Gaps = 28/643 (4%)

Query: 81   EQDEESEHESKTEEQINLDEVNSVDENEPEHKPEEEHIKLD-DANGVDENEVENKPEEHI 139
            + D +S+ +S ++   + D  +  D +       +     D D++   +++ ++  +   
Sbjct: 2687 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2746

Query: 140  KLDDANGVDENSEHSQDLVEHEGEGSSENARTDIESEQHVEKVGEESDNTESKENDSLVK 199
              D  +  D +S+   D        S  ++ +D +S+   +   +   +++S  +     
Sbjct: 2747 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2806

Query: 200  ENEENKHEAENKEAAEVHEEKSQQENEETKDKENEEIKNEVEDTEAGEVKVEKSQQENEE 259
            +++ +     + ++    +  S  +++   D +++   +   D+++       S  +++ 
Sbjct: 2807 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2866

Query: 260  TKDKENEEIKNEVEDKEAGEVKEEKSQQENEETKDKENEEIKNEVEDKEAGEVKEEKSRQ 319
              D +++   +   D ++    +  S  +++   D +++   +   D ++    +  S  
Sbjct: 2867 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2926

Query: 320  ENEETKDKENEEINQNGTDVKDHVEENHEQDSKEEKEESNGTEAEKEEQGKIQEEASSEK 379
            +++   D +++  + + +D     + + + DS  + +  + ++++ +       ++ S+ 
Sbjct: 2927 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 2986

Query: 380  QVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSG 439
               D + +++   + +   D+ S +      D  ++S + ++  D +  ++S+ +S  S 
Sbjct: 2987 D-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS-DSDSDSDSDSDSD-SD 3043

Query: 440  TETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPT-SDGVETVDS 498
            ++++  +DS++ ++  ++  ++ + +D+ S+  S S+S      + ++ + SD     DS
Sbjct: 3044 SDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 3102

Query: 499  SSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKSSSG 558
             S + +++ S +    +  S+  +    DS +D  +    DS++D+  D    T   S  
Sbjct: 3103 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDSDSDSDSNNDSDSDTITDSDS 3162

Query: 559  NSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAET 618
            N  +N++NG+   +     +   +G+    G    +       + +S+      +S + T
Sbjct: 3163 NDGTNSDNGSNSGSDGSSSSNTGSGSGNTTGSTGNNSGTGTGTTTSSTASNNGAASTSTT 3222

Query: 619  NTDSVQNDNVN------------SDGSNTNSE----------GSANDNKEASQVNSSDVS 656
            +  +     V+            SDG+ T S            SA D    S    SD  
Sbjct: 3223 SLSAAATSGVSATAATLAVTTPSSDGAATTSATAATSVVYAAASAQDVDATSDQTDSDSK 3282

Query: 657  SEESKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSV 699
            S    +    S ++  A+    +SN ++NG  + D + N  ++
Sbjct: 3283 SSNDSDKDKKSADTDSADDKVGSSNTDENGKTASDTSNNAGTI 3325



 Score = 67.8 bits (164), Expect = 1e-09
 Identities = 66/268 (24%), Positives = 125/268 (46%), Gaps = 11/268 (4%)

Query: 489 TSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDD 548
           +SD   +  SS+ +G +T+S         +  A+S    +++D++T  +    A  +  +
Sbjct: 36  SSDTASSATSSASSGADTSSAAASAAALAAATASSTSTSTTSDSSTASSSSETASNSNSE 95

Query: 549 VDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQ 608
             S+  SSS +S S+A++ +   TTN     + + +SV      AS  +  ++S +SS  
Sbjct: 96  -SSSDSSSSDDSASDASSASETSTTNATSTSSTSSSSVSTASSSASSASSSSSSSSSSAT 154

Query: 609 KK---DESSNAETNTDSVQNDNVNSDGSNTNSEGS--ANDNKEASQVNSSDVSSEESKEG 663
                D SS++  ++ +    +  S  ++T S  S  A+  K AS   S+   +  S   
Sbjct: 155 SSSLTDSSSSSAASSSTTSLSSSASVAASTVSTASSVASTTKSASTAASTAAIAAYSSVS 214

Query: 664 SSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKD 723
           +++S   S A +  S+S  +  G+ +  A+   + V   T++    AAQ+   E+  A D
Sbjct: 215 AASSHTDSTAAKAASSS-ASLAGSYATLASSYASLVNNLTTQAAVSAAQSAYQEALNAAD 273

Query: 724 ESAHSDEGSN----SNTNDQGSSSDPSI 747
            S H +  +N    + TN  GS+ D +I
Sbjct: 274 LSRHYNSIANMYLDALTNGVGSNVDNAI 301



 Score = 60.8 bits (146), Expect = 1e-07
 Identities = 44/177 (24%), Positives = 90/177 (49%), Gaps = 6/177 (3%)

Query: 600 TASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEE 659
           T+SDT+S      SS A+T++ +     + +  +++ S  + +D+  AS  +SS+ +S  
Sbjct: 35  TSSDTASSATSSASSGADTSSAAASAAALAAATASSTSTSTTSDSSTAS--SSSETASNS 92

Query: 660 SKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESE 719
           + E SS+S +S D+  + S+++E    NA+  ++ + +SV   T+ +   +A + S  S 
Sbjct: 93  NSESSSDSSSSDDSASDASSASETSTTNATSTSSTSSSSV--STASSSASSASSSSSSSS 150

Query: 720 KAKDESAHSDEGSNSNTNDQGSSSDPSITEEVKESHIDLGTLPESNAESNHRDVSSA 776
            +   S+ +D  S+S  +   S++  S +  V  S +   +   S  +S     S+A
Sbjct: 151 SSATSSSLTDSSSSSAAS--SSTTSLSSSASVAASTVSTASSVASTTKSASTAASTA 205



 Score = 57.8 bits (138), Expect = 1e-06
 Identities = 74/309 (23%), Positives = 127/309 (40%), Gaps = 33/309 (10%)

Query: 431 SEMESQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTS 490
           S   S  SG +T+    S A          + + T + S   S+SE+    + E +   S
Sbjct: 42  SATSSASSGADTSSAAASAAALAAATASSTSTSTTSDSSTASSSSETASNSNSESS---S 98

Query: 491 DGVETVDSSSQNGNETTSHTTDKQNETSEDANSKVEDSSTDTTTPKTEDSNADAAGDDVD 550
           D   + DS+S   + + + TT   N TS         SST +++  T  S+A +A     
Sbjct: 99  DSSSSDDSASDASSASETSTT---NATS--------TSSTSSSSVSTASSSASSASSSSS 147

Query: 551 STYKSSSGNS--DSNANNGAYKETTNLVQNENPNGNSVQEGKQDAS-HEAQLTASDTSSE 607
           S+  S++ +S  DS++++ A   TT+L  + +   ++V      AS  ++  TA+ T++ 
Sbjct: 148 SSSSSATSSSLTDSSSSSAASSSTTSLSSSASVAASTVSTASSVASTTKSASTAASTAAI 207

Query: 608 QKKDESSNAETNTDSVQNDNVNSDGSNTNSEGS--------ANDNKEASQVNSSDVSSEE 659
                 S A ++TDS      +S  S   S  +         N+    + V+++  + +E
Sbjct: 208 AAYSSVSAASSHTDSTAAKAASSSASLAGSYATLASSYASLVNNLTTQAAVSAAQSAYQE 267

Query: 660 SKEGSSNSENSS-------DANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQ 712
           +   +  S + +       DA  NG  SN  DN  A   AN    S     S     A+ 
Sbjct: 268 ALNAADLSRHYNSIANMYLDALTNGVGSNV-DNAIAYSGANSLAYSAASAASSYAALAST 326

Query: 713 NESVESEKA 721
             S  S  A
Sbjct: 327 ATSTASSAA 335



 Score = 52.8 bits (125), Expect = 4e-05
 Identities = 41/206 (19%), Positives = 90/206 (42%), Gaps = 7/206 (3%)

Query: 541 NADAAGDDVDSTYKSSSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLT 600
           +AD + D   S   S+S  +D+++   A           +    S       AS     +
Sbjct: 32  SADTSSDTASSATSSASSGADTSS--AAASAAALAAATASSTSTSTTSDSSTAS-----S 84

Query: 601 ASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEGSANDNKEASQVNSSDVSSEES 660
           +S+T+S    + SS++ ++ DS  + +  S+ S TN+  +++ +  +    SS  SS  S
Sbjct: 85  SSETASNSNSESSSDSSSSDDSASDASSASETSTTNATSTSSTSSSSVSTASSSASSASS 144

Query: 661 KEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEK 720
              SS+S  +S +  + S+S+   +   S  ++ +  +    T+ +     ++ S  +  
Sbjct: 145 SSSSSSSSATSSSLTDSSSSSAASSSTTSLSSSASVAASTVSTASSVASTTKSASTAAST 204

Query: 721 AKDESAHSDEGSNSNTNDQGSSSDPS 746
           A   +  S   ++S+T+   + +  S
Sbjct: 205 AAIAAYSSVSAASSHTDSTAAKAASS 230



 Score = 52.0 bits (123), Expect = 7e-05
 Identities = 46/209 (22%), Positives = 95/209 (45%), Gaps = 9/209 (4%)

Query: 521 ANSKVEDSSTDTTTPKTE------DSNADAAGDDVDSTYKSSSGNSDSNANNGAYKETTN 574
           A++   D+S+DT +  T       D+++ AA     +   +SS ++ + +++     ++ 
Sbjct: 28  ADTVSADTSSDTASSATSSASSGADTSSAAASAAALAAATASSTSTSTTSDSSTASSSSE 87

Query: 575 LVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSNAETNTDSVQNDNVNSDGSN 634
              N N   +S      D++ +A  +AS+TS+      SS + ++  +  +   ++  S+
Sbjct: 88  TASNSNSESSSDSSSSDDSASDAS-SASETSTTNATSTSSTSSSSVSTASSSASSASSSS 146

Query: 635 TNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSSDANQNGS--NSNENDNGNASHDA 692
           ++S  SA  +      +SS  SS  +   SS S  +S  +   S  ++ ++ +  AS  A
Sbjct: 147 SSSSSSATSSSLTDSSSSSAASSSTTSLSSSASVAASTVSTASSVASTTKSASTAASTAA 206

Query: 693 NENENSVQRKTSENDGEAAQNESVESEKA 721
               +SV   +S  D  AA+  S  +  A
Sbjct: 207 IAAYSSVSAASSHTDSTAAKAASSSASLA 235



 Score = 49.7 bits (117), Expect = 3e-04
 Identities = 70/355 (19%), Positives = 142/355 (39%), Gaps = 32/355 (9%)

Query: 397 AGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEMESQKSGTETNEVTDSNATTNIQE 456
           + D ASSA    S      S   +          S   S  S + T   +   A+ +  E
Sbjct: 36  SSDTASSATSSASSGADTSSAAASAAALAAATASSTSTSTTSDSSTASSSSETASNSNSE 95

Query: 457 NGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSS---------SQNGNETT 507
           +  ++ +  D+ S+  S SE+        ++ +S  V T  SS         S + + T+
Sbjct: 96  SSSDSSSSDDSASDASSASETSTTNATSTSSTSSSSVSTASSSASSASSSSSSSSSSATS 155

Query: 508 SHTTDKQNETSED------------ANSKVEDSSTDTTTPKTEDSNADAAGDDVDSTYKS 555
           S  TD  + ++              A S V  +S+  +T K+  + A  A     S+  +
Sbjct: 156 SSLTDSSSSSAASSSTTSLSSSASVAASTVSTASSVASTTKSASTAASTAAIAAYSSVSA 215

Query: 556 SSGNSDSNANNGAYKETTNLVQNENPNGNSVQEGKQDASHEAQLTASDTSSEQKKDESSN 615
           +S ++DS A   A   + +L  +     +S      + + +A ++A+  S+ Q+   +++
Sbjct: 216 ASSHTDSTAAKAA-SSSASLAGSYATLASSYASLVNNLTTQAAVSAAQ-SAYQEALNAAD 273

Query: 616 AETNTDSVQNDNV----NSDGSNTNSEGSANDNKEASQVNSSDVSSEESKEGSSNSENSS 671
              + +S+ N  +    N  GSN ++  + +     +   +S  SS  +   ++ S  SS
Sbjct: 274 LSRHYNSIANMYLDALTNGVGSNVDNAIAYSGANSLAYSAASAASSYAALASTATSTASS 333

Query: 672 DANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESEKAKDESA 726
            A Q   N       ++++ A  +  S     + +  EAA +  +  +  K+ +A
Sbjct: 334 AATQGLINL-----ASSNYSAASSAASAATVAASSAAEAANSAYLAMQYDKNNTA 383



 Score = 39.7 bits (91), Expect = 0.35
 Identities = 71/384 (18%), Positives = 148/384 (38%), Gaps = 50/384 (13%)

Query: 375 ASSEKQVQDGEGNNEQHREENYAGDNASSAVDHKSQDIFNESYNKTEQVDKNEKNESEME 434
           +SSE        ++      + +  +ASSA               +E    N  + S   
Sbjct: 84  SSSETASNSNSESSSDSSSSDDSASDASSA---------------SETSTTNATSTSSTS 128

Query: 435 SQKSGTETNEVTDSNATTNIQENGGENQAQTDNGSEKRSTSESGGQQHQEQNNPTSDGVE 494
           S    T ++  + ++++++   +   + + TD+ S   ++S +        ++  S    
Sbjct: 129 SSSVSTASSSASSASSSSSSSSSSATSSSLTDSSSSSAASSST-----TSLSSSASVAAS 183

Query: 495 TVDSSSQNGNETTSHTTDKQNETSEDANS-KVEDSSTDTTTPKTEDSNADAAGD--DVDS 551
           TV ++S   + T S +T          +S     S TD+T  K   S+A  AG    + S
Sbjct: 184 TVSTASSVASTTKSASTAASTAAIAAYSSVSAASSHTDSTAAKAASSSASLAGSYATLAS 243

Query: 552 TYKSSSGNSDS----NANNGAYKETTN---LVQNENPNGNSVQEGKQDASHEAQLTASDT 604
           +Y S   N  +    +A   AY+E  N   L ++ N   N   +   +        A   
Sbjct: 244 SYASLVNNLTTQAAVSAAQSAYQEALNAADLSRHYNSIANMYLDALTNGVGSNVDNAIAY 303

Query: 605 SSEQKKDESSNAETNTDSVQNDNVNSDGSNTNSEG-----SANDNKEASQVNSSDVSSEE 659
           S       S+ +  ++ +       S  S+  ++G     S+N +  +S  +++ V++  
Sbjct: 304 SGANSLAYSAASAASSYAALASTATSTASSAATQGLINLASSNYSAASSAASAATVAASS 363

Query: 660 SKEGSSNSENSSDANQNGSNSNENDNGNASHDANENENSVQRKTSENDGEAAQNESVESE 719
           + E ++++  +   ++N +             A  +  +V   T+     AA N +  + 
Sbjct: 364 AAEAANSAYLAMQYDKNNT-------------AVTSAYTVASSTAAAASTAAVNATTAAV 410

Query: 720 KAKDESAHSDEGSNSNTNDQGSSS 743
            A   SA++   SN+  ND  ++S
Sbjct: 411 AA--SSAYAAVSSNAANNDYEATS 432



 Score = 36.6 bits (83), Expect = 2.9
 Identities = 51/232 (21%), Positives = 93/232 (39%), Gaps = 23/232 (9%)

Query: 465 TDNGSEKRSTSESGGQQHQEQNNPTSDGVETVDSSSQNGNETTSHTTDKQNETSEDANSK 524
           T+  S   S + S       Q    S  +    SS+       S+ T + N +   A+S 
Sbjct: 693 TEIASSYASQANSAASVATSQAVAASSAISLASSSANLTGSLASYYTSQANSSYNAASSY 752

Query: 525 VE---DSSTDTTTPKTEDSNADAAGD--------DVDSTYKSSSGNSDSNANNGAYKETT 573
                ++++  T   T  ++ +A G